Startseite » Produkt Suche » Industrielle Anlagen und Zusatzteile »

Trockanlage

( Über 17618 Produkte gefunden )
Produkt-Katalog Herstellerübersicht
Seite 140/588  
China-Lieferant - Gold-Mitglied
Sortieren nach: Bedeutung
Zeigen: 30 artikel

Qualitäts-neuer Zustands-Förderwerk-Mikrowellen-Trockner

Einheitspreis: US $ 12000 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, EXW, CIF, DAT, FAS, DDP, DAP, CIP, CPT, FCA

Heißer Verkauf New Zustand Conveyor Mikrowellentrockner 1.Description: 1).A Conveyor der Mikrowellentrockner, häufig mündlich verkürzt zu landwirtschaftlichem, ist ein Küchegerät, das Nahrung ...

Jinan Kelid Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

CER neuer Standardzustands-industrieller Kelp-Mikrowellenherd

Einheitspreis: US $ 12000 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, EXW, CIF, DAT, FAS, DDP, DAP, CIP, CPT, FCA

Kelp-Mikrowellenherd des heißen Verkauf New Zustandes industrieller 1.Description: ist der industrielle Mikrowellenherd des Kelps 1).A häufig mündlich verkürzt zu landwirtschaftlichem, ein ...

Jinan Kelid Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

Qualitäts-neuer Zustands-industrieller Kelp-Mikrowellen-Trockner

Einheitspreis: US $ 12000 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, EXW, CIF, DAT, FAS, DDP, DAP, CIP, CPT, FCA

Kelp-Mikrowellentrockner des heißen Verkauf New Zustandes industrieller 1.Description: ist der industrielle Mikrowellentrockner des Kelps 1).A häufig mündlich verkürzt zu landwirtschaftlichem, ein ...

Jinan Kelid Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

Großes Capacity Grain Dryer Tower Grain Dryer Rice Paddy Dryer für Drying Paddy, Maize, Corn

Einheitspreis: US $ 20000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF

1.The Features der Grain Dryer Maschine: 1). Korn Dryer pre-installed mit Zeitbegrenzungmodus, Selbstmodus und sät Modus für die verschiedenen Getreide, die Bedingungen trocknen 2). Mehr ...

Mobiler Korn-Trockner

Einheitspreis: US $ 20000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF

1.The Features der Grain Dryer Maschine: 1). Korn Dryer pre-installed mit Zeitbegrenzungmodus, Selbstmodus und sät Modus für die verschiedenen Getreide, die Bedingungen trocknen 2). Mehr ...

China-Vakuumlaborofen mit niedrigem Preis

Einheitspreis: US $ 850.0-1999.0 / set
MOQ: 1 set
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, EXW

China-Vakuumlaborofen mit niedrigem Preis 1.Scope der Anwendung des Laborofens: Vakuumtrockenofen ist- für, für eine Vielzahl der Vakuumtrocknerbehandlung der kleinen Proben unterrichten und ...

Tischplattentyp UVlicht, das verfestigenmaschine der Maschinen-Rx200-1 aushärtet

Tischplattentyp UVlicht, das trocknende Maschine der Maschinen-RX200-1 aushärtet 1. Zweck Diese Maschine wird hauptsächlich, beim Aushärten und getrocknet sofort verwendet, geeignet für ...

Shantou Glorythai Packing Equipment Co., Ltd.

[Provinz: Guangdong, China]

Hochgeschwindigkeitsfliehkraftspray-granulierender Trockner

Einheitspreis: US $ 5000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Anwendung des Spraytrockners Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für Labor verwendet; grosser Typ Spraytrockner ist für ...

China High Speed Spray Dryer für Ceramic

Einheitspreis: US $ 5000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Anwendung des Spraytrockners Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für Labor verwendet; grosser Typ Spraytrockner ist für ...

Spray Dryer for Ceramic Granule

Einheitspreis: US $ 5000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Application of spray dryer spray dryer is used for small industrial production purpose or for doing experiment, for lab; big type spray dryer is for mass industrial production of milk powder, protein, ...

Spray Dryer für Organic Solvent

Einheitspreis: US $ 5000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Anwendung des Spraytrockners Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für Labor verwendet; grosser Typ Spraytrockner ist für ...

Edelstahl Lab Spray Dryer für Small Production Test

Einheitspreis: US $ 7000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Experimenteller Spraytrockner Product Overview: Die Maschine verwendet gekapselt, alle Maschinenteile werden gebildet vom Edelstahl der Qualitäts 304, mit Mittel eines höheren Wiederanläufen der ...

HochgeschwindigkeitsCentrifugal Spray Dryer für Egg Powder

Einheitspreis: US $ 5000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

Spray-Trockner - trocknende Maschine (LPG-5)

Einheitspreis: US $ 5500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

Lpg-Serien-Spray-trocknende Maschine (LPG-5)

Einheitspreis: US $ 5500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

GlasChamber Mini Spray Dryer für Lab/Pilot/Test

Einheitspreis: US $ 5000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Name: Kleiner Laborspraytrockner, Minispraytrockner, beweglicher Versuchsspraytrockner Beschreibung: Ist Minispraytrockner des labor OM1500 (Einheit) ein Division, das ich die neue Technologie ...

Lpg-Hochgeschwindigkeitsfliehkraftspray-Trockner-Maschine

Einheitspreis: US $ 5500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

Fliehkraftmilch-Spray-trocknende Maschine

Einheitspreis: US $ 5500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

Pharmazeutische Centifugal Spray-trocknende Hochgeschwindigkeitsmaschine GMP-

Einheitspreis: US $ 5500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

Chinesisches Hot Sale Spray Dryer für Starch

Einheitspreis: US $ 5500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

Heißes Sale Spray Dryer für Vitamin

Einheitspreis: US $ 5500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

LPG Hohes-Speed Spray Dryer für Washing Powder

Einheitspreis: US $ 5500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

Kleine Labormaschinen-Kräuterpuder-Spray-Trockner

Einheitspreis: US $ 5500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

Laborstufe-pharmazeutischer Maschinen-Spray-Trockner

Einheitspreis: US $ 5500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

Industrielles Spray Dryer für Instant Coffee

Einheitspreis: US $ 5500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

HochgeschwindigkeitsCentrifugal Spray Dryer für Dyestaff/Pigment

Einheitspreis: US $ 5000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

HochgeschwindigkeitsCentrifugal Spray Dryer für Drying Chemical Liquid

Einheitspreis: US $ 5000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

HochgeschwindigkeitsCentrifugal Spray Dryer für Drying Carbon White

Einheitspreis: US $ 5000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

HochgeschwindigkeitsCentrifugal Spray Dryer für Drying Resin/Polymer

Einheitspreis: US $ 5000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

HochgeschwindigkeitsCentrifugal Spray Dryer für Drying Cocoa/Blood/Juice

Einheitspreis: US $ 5000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

Brauchen Sie Hilfe?
Kontaktieren Sie bitte uns.