Startseite » Produkt Suche » Industrielle Anlagen und Zusatzteile »

Trockanlage

( Über 17875 Produkte gefunden )
Produkt-Katalog Herstellerübersicht
Seite 179/596  
China-Lieferant - Gold-Mitglied
Sortieren nach: Bedeutung
Zeigen: 30 artikel

CT-C-I Hot Air Circulating Drying Oven (100kg/batch)

Einheitspreis: US $ 5000.0-6000.0 / set
MOQ: 1 set
Handelsbedingungen: FOB, CFR, CIF

Produkt-Beschreibung Der Heißluftzirkulation der CTC-Serie Trockenofen nimmt Geräuschbeseitigung und thermisches beständiges Strömunggebläse- und automatischestemperaturüberwachungsystem an. Das gesamte ...

Egge-Vakuumtrockner

Einheitspreis: US $ 50000 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF

1, Anwendungs-Bereich PZG Harrow Vacuum Dryer unserer Firma ist für das Trocknen des wärmeempfindlichen Materials verwendbar, ist das Material einfache Oxidation unter der Hochtemperatur, oder das ...

CER 50kg Hooper Dryer Machine Industrial für Plastic Granules

MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, EXW

Böttcher-Trocknermaschine des CERS 50kg industriell für Plastikkörnchen Funktionsgrundregel Heißluft vom Rohr der elektrischen Heizung arbeitet an Rohstoff, wird heißes feuchtes in einen Apportierhund, ...

Jiangmen Xiecheng Machinery Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Gekühltes Compressed Air Compressor Dryer für Truck

Einheitspreis: US $ 3200.0-3400.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DAT, FAS, DDP, DAP, CIP, CPT, FCA, EXW

Firma-Informationen Guangzhou AirHorse Compressor Co., Ltd. ist die Berufsherstellung und der Exporteur. Wir werden auf die Luftverdichterforschung, -entwicklung und -produktion spezialisiert. Die ...

Guangzhou Airhorse Compressor Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Gekühlter Druckluft-Verdichter-trockenere Luft-Fluss

Einheitspreis: US $ 6300.0-6600.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DAT, FAS, DDP, DAP, CIP, CPT, FCA, EXW

Firma-Informationen Guangzhou AirHorse Compressor Co., Ltd. ist die Berufsherstellung und der Exporteur. Wir werden auf die Luftverdichterforschung, -entwicklung und -produktion spezialisiert. Die ...

Guangzhou Airhorse Compressor Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Nasan Prüfung-vorbildlicher Mikrowellen-Trockner

Einheitspreis: US $ 5000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Zerstörungsfreie Prüfung Model Tunnel-Typ Microwave Trockner 1. Geräteneffekt sofort, schalten justierbares an, die justierbare Übertragungsdrehzahl, keine thermischen Schwungkraftrückstände, ...

Shanghai Nasan Industry Co., Ltd.

[Provinz: Shanghai, China]

Anbieter Lieferant

Yzg Vacuum Drying Machine auf Hot Sales

Einheitspreis: US $ 10000.0-50000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB

1.Advantages: der 1).The Wärmeverlust von verdunsten ist kleiner 2).It gehört statischem drier.so, welches die Form des getrocknet zu werden Rohstoffs nicht zerstört werden kann 3).The ...

High-Efficiency Fluidizing Drier für Sale

Einheitspreis: US $ 10000.0-50000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB

High-Efficiency Fluidizing Drier für Sale 1.Advantages: Struktur 1).The des Fluidisierungbetts ist um, um tote Ecke zu vermeiden 2). Die trocknende Drehzahl ist schnell und die Temperatur ist, ...

Hohes Effective Grinder Machine auf Sale

Einheitspreis: US $ 10000.0-50000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB

1.Advantages: 1).Can wird angepasst tote Ecke 2).No in der Reinigung 3).High wirkungsvoll, enery Einsparung und lärmarmes 2.Specification: 3.Our Company: Maschinerie Co.Ltd.is ...

Hochgeschwindigkeitsfliehkraftspray-trocknende Maschine

Einheitspreis: US $ 13800 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DAT, FAS, DDP, DAP, CIP, CPT, FCA, EXW

Einfache Anweisung: Das Sprayabdampfen ist die Technologie, die in der flüssigen formenden Technologie und in der trocknenden Industrie am meisten am benutztesten ist. Die trocknende Technologie ist ...

Ruian Leadtop Imp&Exp Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Bewegliches Klimaanlage Compresor Trockenmittel

Einheitspreis: US $ 200 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, EXW

Bedingungen 1. 2 Gebläse-Drehzahlen (Höhe - niedrig) 2. Automatisch stoppen, wenn Wasser gefüllt wird 3. Den Stummen halten, energiesparend 4. Zeit Einstellung festsetzen

TM-UV750L heißer Verkaufs-aushärtende Beschichtung-UVmaschine

MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, EXW, CIF, FCA

TM-UV750L aushärtende UVmaschine des heißen Verkaufs Technische Parameter: Anwendung: Sie ist zutrifft auf die Spezialeffekte wie Knicke, bereiften Brechungedelsteinkristall und konvexes ...

Tamprinter Printing Machinery Limited

[Provinz: Guangdong, China]

Anbieter Lieferant

Gekühlte Luft-Trockner-Fabrik

Einheitspreis: US $ 1000.0-19000.0 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF, EXW

Gekühlte Luft-Trockner-Fabrik: Produkt-Beschreibung: Der vordere Luft-kühlende Vorkühler und der Kondensator im Kühlsystem verwenden das vorverlegte Ventilationssystem für das Abkühlen, die ...

Elang Industrial (Shanghai) Co., Ltd.

[Provinz: Shanghai, China]

Anbieter Lieferant

TM-UV750L Metallblatt-aushärtende trockenere UVmaschine

Einheitspreis: US $ 2830 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, EXW, CIF, FCA

TM-UV750L aushärtende UVmaschine Technische Parameter: TM-UV750 aushärtende UVmaschine 2.55m*1.05m*1.45m Furnierholz ...

Tamprinter Printing Machinery Limited

[Provinz: Guangdong, China]

Anbieter Lieferant

TM-UV1000L aushärtende UVmaschine für Plastikvorstand

MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, EXW, CIF, DDP, FCA

Produkt-Beschreibung Aushärtender Maschinen-UVlieferant (TM-UV1000L) Technische Parameter: Anwendung: Sie ist zutrifft auf die Spezialeffekte wie Knicke, bereiften Brechungedelsteinkristall und ...

Tamprinter Printing Machinery Limited

[Provinz: Guangdong, China]

Anbieter Lieferant

Hochgeschwindigkeitsfliehkraftspray-granulierender Trockner

Einheitspreis: US $ 5000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Anwendung des Spraytrockners Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für Labor verwendet; grosser Typ Spraytrockner ist für ...

China High Speed Spray Dryer für Ceramic

Einheitspreis: US $ 5000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Anwendung des Spraytrockners Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für Labor verwendet; grosser Typ Spraytrockner ist für ...

Spray Dryer for Ceramic Granule

Einheitspreis: US $ 5000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Application of spray dryer spray dryer is used for small industrial production purpose or for doing experiment, for lab; big type spray dryer is for mass industrial production of milk powder, protein, ...

Spray Dryer für Organic Solvent

Einheitspreis: US $ 5000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Anwendung des Spraytrockners Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für Labor verwendet; grosser Typ Spraytrockner ist für ...

Niedrige Temperatur-organisches Lösungsmittel-Vakuumtrockner

Einheitspreis: US $ 4500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CIF, CIP, EXW

Funktions-Grundregel Es ist ein horizontaler Chargen-artiger Trockner der Innovation Vakuum. Das feuchtere des nassen Materials wird durch Wärmeübertragung verdunstet. Der Mischer mit Gummiwalze löscht ...

Zweistufiger Transformator-Vakuumtrockner

Einheitspreis: US $ 1.0-100000.0 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF, DAT, FAS, DDP, DAP, CIP, CPT, FCA, EXW

Verwendet für den Vakuumtrockner und Vakuum, die für elektrischen Hochspannungstransformator als 220KV, 500KV, ±800KV, 1000KV Öl-einspritzen. Starke Vakuumpumpen bilden Arbeitsvakuumgrad bis 10 PA und ...

Chuangke Plate Dryer für Pesticide Granular

Einheitspreis: US $ 12500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CIF, DDP, EXW

Plattentrocknereinleitung Ist kontinuierlicher Plattentrockner der PLG Serie eine Art hohem Leistungsfähigkeits-Leiten und kontinuierlichem trocknendem Gerät. Seine eindeutige Struktur und Arbeitsprinzip ...

DrehContinuous Plate Dryer für Drying Chemical Powder

Einheitspreis: US $ 12500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CIF, DDP, EXW

Plattentrocknereinleitung Ist kontinuierlicher Plattentrockner der PLG Serie eine Art hohem Leistungsfähigkeits-Leiten und kontinuierlichem trocknendem Gerät. Seine eindeutige Struktur und Arbeitsprinzip ...

Niedriges Energy Consumption Plate Dryer für Pesticide

Einheitspreis: US $ 12500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CIF, DDP, EXW

Plattentrocknereinleitung Ist kontinuierlicher Plattentrockner der PLG Serie eine Art hohem Leistungsfähigkeits-Leiten und kontinuierlichem trocknendem Gerät. Seine eindeutige Struktur und Arbeitsprinzip ...

DrehTray Dryer für Drying Pesticide

Einheitspreis: US $ 12500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CIF, DDP, EXW

Drehtellersegmenttrocknereinleitung Ist kontinuierlicher Plattentrockner der PLG Serie eine Art hohem Leistungsfähigkeits-Leiten und kontinuierlichem trocknendem Gerät. Seine eindeutige Struktur und ...

Plate Dryer für Drying Fumaric Acid/Amino Phenol/Melamine fortsetzen

Einheitspreis: US $ 12500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CIF, DDP, EXW

Plattentrocknereinleitung Ist kontinuierlicher Plattentrockner der PLG Serie eine Art hohem Leistungsfähigkeits-Leiten und kontinuierlichem trocknendem Gerät. Seine eindeutige Struktur und Arbeitsprinzip ...

Plate Dryer für Drying Organic Chemicals fortsetzen

Einheitspreis: US $ 12500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CIF, DDP, EXW

Plattentrocknereinleitung Ist kontinuierlicher Plattentrockner der PLG Serie eine Art hohem Leistungsfähigkeits-Leiten und kontinuierlichem trocknendem Gerät. Seine eindeutige Struktur und Arbeitsprinzip ...

Plate Dryer für Drying Inorganic Chemicals fortsetzen

Einheitspreis: US $ 12500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CIF, DDP, EXW

Plattentrocknereinleitung Ist kontinuierlicher Plattentrockner der PLG Serie eine Art hohem Leistungsfähigkeits-Leiten und kontinuierlichem trocknendem Gerät. Seine eindeutige Struktur und Arbeitsprinzip ...

Plate Dryer für Drying Calcium Carbonate fortsetzen

Einheitspreis: US $ 12500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CIF, DDP, EXW

Plattentrocknereinleitung Ist kontinuierlicher Plattentrockner der PLG Serie eine Art hohem Leistungsfähigkeits-Leiten und kontinuierlichem trocknendem Gerät. Seine eindeutige Struktur und Arbeitsprinzip ...

Plate Dryer für Drying Magnesium Carbonate/Aluminum Oxide fortsetzen

Einheitspreis: US $ 12500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CIF, DDP, EXW

Plattentrocknereinleitung Ist kontinuierlicher Plattentrockner der PLG Serie eine Art hohem Leistungsfähigkeits-Leiten und kontinuierlichem trocknendem Gerät. Seine eindeutige Struktur und Arbeitsprinzip ...

Brauchen Sie Hilfe?
Kontaktieren Sie bitte uns.