Startseite » Sport und Erholung » Schlafsack » Beutel nach unten
Schnellproduktverzeichnis Schnelllieferantenverzeichnis
Seite 322/3260  
Insgesamt 97772 Produkte von etwa 4250

Beutel nach unten

Hersteller & Lieferanten
China-Lieferant - Gold-Mitglied
Sortieren nach: Relevanz
Zeigen: 30 artikel

Self-Feeding LKW des Mobile-4 des Betonmischer-M3 für kleinere Projekte

Einheitspreis: US $ 35000.0-40000.0 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:DWSL 3.85
Art:Concrete Mixing Truck
Spritzbeton-Typ:Nass
Bearbeitungsprozess:Hydraulisch
Struktur:Zylinder Typ
Feeding Höhe:1390mm

Sofortige Nudel, die Maschine herstellt

Einheitspreis: US $ 25000.0-35000.0 / Set
MOQ: 1 Set

Modell Nr.:KLD- instant noodle making machine
Bescheinigung:CEISO 9001
Energiequelle:Elektro
Automatischer Grad:Automatische
Kundenspezifische:Kundenspezifische
Warenzeichen:KLD

Jinan Kelid Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

Zufuhr-additive Reis-Protein-Mahlzeit für Tierfutter

Einheitspreis: US $ 450.0-600.0 / Ton
MOQ: 20 Tonnen

Modell Nr.:STS003
Bescheinigung:SGS
Form:Pulver
Warenzeichen:STS
Verpackung:50kg or 25kg Per Woven Bag or Kraft Bag
Standard:50kg or 25kg Per Bag

WD STS BIOL. DEVELOPMENT CO., LIMITED

[Provinz: Shandong, China]

Anbieter Lieferant

im Herbst 2016 neuer Form-Zubehör-Beutel-Beutel-Kleinsendung der Cubs-Crossbody (GB#113)

Einheitspreis: US $ 3.4 / Stück
MOQ: 1000 Stück

Modell Nr.:GB#113
Härte:Medium Soft
Farbe:Rot
Entwurf:Horizontal Quadrat
Mode Element:Kontrast Farbe
Innenmaterial:Baumwolle

Grandsea Bag & Case Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Euramerican Stern-Veloursleder gesponnener Beutel scheuern eingesäumtes Beutel-Schulter-diagonales ...

Einheitspreis: US $ 3.1 / Stück
MOQ: 1000 Stück

Modell Nr.:GB#1688
Härte:Medium Soft
Farbe:Braun
Entwurf:Horizontal Quadrat
Mode Element:Kontrast Farbe
Innenmaterial:Baumwolle

Grandsea Bag & Case Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Japan 2016 mit Geometric Folding Single Shoulder Bag/Fashion Big Diamond Lattice Stitching Bags ...

Einheitspreis: US $ 3.6 / Stück
MOQ: 1000 Stück

Modell Nr.:GB#6X6
Härte:Medium Soft
Farbe:Einfarbige
Entwurf:Horizontal Quadrat
Mode Element:Kontrast Farbe
Innenmaterial:Baumwolle

Grandsea Bag & Case Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Die neue europäische diagonale Stadtstreicherin des Sen-Woven Bag Cover PU Bag (GB#002)

Einheitspreis: US $ 2.4-2.8 / Stück
MOQ: 1000 Stück

Modell Nr.:GB#002
Härte:Medium Soft
Farbe:Einfarbige
Entwurf:Horizontal Quadrat
Mode Element:Kontrast Farbe
Innenmaterial:Baumwolle

Grandsea Bag & Case Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Der Luxuxpaket-Explosion-Diana-Paket-Perlen-Ketten-Beutel-/Lady-Handtaschen-Typ hochwertig ...

Einheitspreis: US $ 6.40 / Stück
MOQ: 1000 Stück

Modell Nr.:GB#CE0401#
Härte:Medium Soft
Farbe:Einfarbige
Entwurf:Horizontal Quadrat
Mode Element:Kontrast Farbe
Innenmaterial:Baumwolle

Grandsea Bag & Case Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Eis-Gefäß-Maschine, Eis-Gefäß-Hersteller

Einheitspreis: US $ 1000.0-1000000.0 / Stück
MOQ: 1 Stück

Modell Nr.:JY-T001
Eisherstellung:Eintauchen
Kühl Way:Luftgekühlte
Automatisierung:Automatisierung
Geräteaufbau:Integral
Maschinen-Größe:Medium

Shanghai Jingyao Industrial Co., Ltd.

[Provinz: Shanghai, China]

Anbieter Lieferant

Klare Werbung Aufblasbare Blase Ball für Show

Einheitspreis: US $ 600.0-800.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:BU Tent
Art:Zelt
Aufblasbaren Gas:Luft
Anwendung:Anzeige
Technics:Nähen
Material:PVC

Guangzhou U-Rides Attraction Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Rotary Die Leiter Film -durchbrennenmaschine

Einheitspreis: US $ 11500.0-16000.0 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:SJ-B
Art:PE Film Blowing Machine
Rohstoff:PE
Automatisierung:Automatisch
Computerized:Non-Computerized
Bescheinigung:CESGS

Ruian Queensense Machine Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Harte Karton-Qualitäts-Papierverpackenkasten (WALD, der 018 PACKT)

Einheitspreis: US $ 0.25-0.59 / Stück
MOQ: 2000 Stück
Handelsbedingungen: FOB, CFR, CIF, DAT, FAS, DDP, DAP, CIP, CPT, FCA, EXW

Modell Nr.:FOREST PACKING 018
Anwendung:LebensmittelKleider
Material:Papier
Drucken Page:Single
Art:Kosmetiktücher
Gewicht:300

Shanghai Forest Packing Co., Ltd.

[Provinz: Shanghai, China]

Anbieter Lieferant

Harter Vorstand-verpackender Papierkasten für Haar

Einheitspreis: US $ 0.39-0.67 / Stück
MOQ: 1000 Stück
Handelsbedingungen: FOB, CFR, CIF, DAT, FAS, DDP, DAP, CIP, CPT, FCA, EXW

Modell Nr.:FP1100051
Anwendung:Lebensmittel,Haushalt,Elektronisch,KosmetikaKleider
Material:Papier
Drucken Page:Single
Art:Kosmetiktücher
Gewicht:300

Shanghai Forest Packing Co., Ltd.

[Provinz: Shanghai, China]

Anbieter Lieferant

Schützender verpackender Papierkasten

Einheitspreis: US $ 0.27 / Stück
MOQ: 2000 Stück
Handelsbedingungen: FOB, CFR, CIF, DAT, FAS, DDP, DAP, CIP, CPT, FCA, EXW

Modell Nr.:FP1100071
Anwendung:Haushalt
Material:Papier
Drucken Page:Single
Art:Kosmetiktücher
Gewicht:300

Shanghai Forest Packing Co., Ltd.

[Provinz: Shanghai, China]

Anbieter Lieferant

Speiseeiszubereitung des Gefäß-1t maschinell hergestellt in China

Einheitspreis: US $ 10000 / Set
MOQ: 1 Set
Handelsbedingungen: FOB

Modell Nr.:FIC-10G
Eisherstellung:Eintauchen
Kühl Way:Luftgekühlte
Automatisierung:Automatisierung
Geräteaufbau:Integral
Maschinen-Größe:Klein

EDDHA F.E. 6% mit guter Qualität

Einheitspreis: US $ 3200.0-4000.0 / Ton
MOQ: 1 Ton
Handelsbedingungen: FOB, CFR, CIF, DDP

Modell Nr.:eddha fe 6
Bedingung:Neu
Zertifizierung:UL,ISO9001,TÜV,GMP,ISO,SGSCE
Anwendung:Gemüse,BlumenFrucht
Aussehen:Pulver
Infektion auf Boden:Physiologische Alkaline

Agar-Agar der Lebensmittel-Zusatzstoff-Qualitäts-Bp/FCCIV E406

Einheitspreis: US $ 1 / Ton
MOQ: 1 Ton
Handelsbedingungen: FOB

Modell Nr.:Agar agar
Ressource:Natürlich
Warenzeichen:Fooding
Verpackung:25kg
Standard:GMP
Herkunft:China

Fooding Group Limited

[Provinz: Shanghai, China]

Anbieter Lieferant

Zubehör-freies Beispielnahrungsmittelgrad-Agar-Agar

Einheitspreis: US $ 1 / Ton
MOQ: 1 Ton
Handelsbedingungen: FOB

Modell Nr.:Agar Agar
Nährwert:Nutritional
Bescheinigung:ISO
Verpackungsmaterial:Metall
Speichermethode:Normal
Haltbarkeit:> 12 Monate

Fooding Group Limited

[Provinz: Shanghai, China]

Anbieter Lieferant

Breiter Film-durchbrennenmaschine des Film-Drehkopf-ABA

Einheitspreis: US $ 32000.0-36000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:QS-ABA1200
Art:PE Film Blowing Machine
Rohstoff:HDPE
Maximale Folding Breite Film:1200mm
Schneckendurchmesser:65mm
Automatisierung:Automatisch

Ruian Queensense Machine Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Automatische Plastikfilm-durchbrennenmaschine der Geschwindigkeit-HDPE&LDPE

Einheitspreis: US $ 25000.0-27000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DAT, FAS, CIP, CPT, FCA

Modell Nr.:QS-AH50/55/60/65
Art:PE Film Blowing Machine
Rohstoff:PE
Maximale Folding Breite Film:1200mm
Schneckendurchmesser:50mm
Automatisierung:Automatisch

Ruian Queensense Machine Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Automatisches PET Hochgeschwindigkeitsplastikfilm-durchbrennenmaschine

Einheitspreis: US $ 25000.0-27000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DAT, FAS, CIP, CPT, FCA

Modell Nr.:QS-A-H50/55/60/65
Art:PE Film Blowing Machine
Rohstoff:PE
Maximale Folding Breite Film:1200mm
Schneckendurchmesser:50mm
Automatisierung:Automatisch

Ruian Queensense Machine Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Doppelter Schraubenzieher des China-Cer-PP/PA/ABS in der doppelten ...

Einheitspreis: US $ 19999.0-99999.0 / Stück
MOQ: 1 Stück

Modell Nr.:TSE-135A
Produkttyp:Granulierextruder
Feeding-Modus:Ein-Feed
Assembly Structure:Separate Nextruder
Schraube:Twin-Screw
Engagement-System:Vollineinander

Haifisch Theme Inflatable Slide für Amusement Parks (CHSL1100)

MOQ: 1 Stück

Modell Nr.:CHSL1100
Material:PVC
Verwendung:Wasserpark
Art:Outdoor-Slide
Alter:5-7 Jahre
Kundenspezifische:Kundenspezifische

Automatische reine Wasser-Flaschen-Hülseshrink-Paket-Maschine

Einheitspreis: US $ 9000.0-11000.0 / Set
MOQ: 1 Set

Modell Nr.:BMD-800A
Anwendung:Lebensmittel,Ware,Machinery & Hardware,Textil-,Alkohol und Tabak,Spielzeug,Chemikalie,Kleider,Geschenke & ArtsMedizinisch
Verpackung:Film
Automatischer Grad:Automatisch
Driven Typ:Elektrisch
Stellen Sie Schnell:Frequenzkonversion Speed ​​Regulation

Automatisches Gelee-Cup-thermische Kontraktion-Schrumpfverpackung-Maschine

Einheitspreis: US $ 6000.0-8000.0 / Set
MOQ: 1 Set

Modell Nr.:BS-400LA+BMD-450C
Anwendung:Lebensmittel,Ware,Machinery & Hardware,Textil-,Alkohol und Tabak,Spielzeug,Chemikalie,Kleider,Geschenke & Arts,Speise-Medizinisch
Verpackung:Film
Automatischer Grad:Automatisch
Driven Typ:Elektrisch
Art und Weise der Verpackung:Vierseitendichtungstyp

Laser-Ausschnitt-Maschine für Metallblatt und -rohre

Einheitspreis: US $ 85000.0-150000.0 / Stück
MOQ: 1 Stück

Modell Nr.:1530
Kundenspezifische:Nicht Customized
Schneidstoff:Kupfer,Kohlenstoffstahl,Eisen,Aluminium,MetalllegierungRostfreier Stahl
Automatischer Grad:Automatische
Schneidemodus:Laser schneiden
Warenzeichen:JQ

Völlig Automobil-nicht gesponnener Beutel, der Maschine Ultraschalldichtung bildet

Einheitspreis: US $ 108000.0-128000.0 / Set
MOQ: 1 Set

Modell Nr.:XYFD-500
Linien:1
Spannung:380V
Geschwindigkeit:Hoch
Continuous-Rolled:Keine
Schicht:Single

faltende frei versendende Silikon-Nahrungsmittelbeutel-Dichtungs-Klipp-Träger-Kanal ...

Einheitspreis: US $ 0.51-0.55 / Stück
MOQ: 500 Stück

Modell Nr.:dxc65
Warenzeichen:DAXIN
Verpackung:1X Silicone Tie Beam Port, 5 X Bag Sealing Clip
Standard:silicone
Herkunft:Dongguan City Guangdong Province
HS-Code:3926909090

Liebes-Inner-Form-Eis-Tellersegment-Biskuit-Form-Plätzchen-Form-Kuchen-Backen-Hilfsmittel

Einheitspreis: US $ 6.49-6.56 / Stück
MOQ: 500 Stück

Modell Nr.:dxl881
Art:Baking Tools & Accessories
Material:Silikon
Warenzeichen:DAXIN
Verpackung:1piece/OPP Bag
Standard:silicone

Fabrik-Preis-Doppelt-Weg-aufblasbares vertikales Ansturm-Plättchen für Spaß (chsl582)

Einheitspreis: US $ 2000 / Stück
MOQ: 1 Stück

Modell Nr.:chsl582
Material:PVC
Verwendung:Familie
Art:Outdoor-Slide
Alter:8-11 Jahre
Kundenspezifische:Kundenspezifische
Brauchen Sie Hilfe?
Kontaktieren Sie bitte uns.
Verwandte Schnellsuche Kategorien
Wir bieten Ihnen ein komplettes Sortiment an Sportwaren und Sportausrüstung für Ihre gesamte Sportartikelnachfrage. Unsere chinesischen Lieferanten verfügen über den größten Bestand an qualitativen Sportartikeln, Jagd-, Angel- und Campingausrüstungen. Erfahren Sie mehr über die neuesten Nachrichten von der Sportartikelindustrie in unserem Handelsressourcencenter. Unser ausgezeichneter Einkäuferservice freut sich, Ihnen beim Auffinden von schwer erhältlichen Artikeln der Freizeitindustrie zu helfen. Es gibt eine Vielzahl von Sport- und Freizeitartikeln auf unserer Webseite, einschließlich obige Beutel Nach Unten fabrik, und Sie können zwischen anderen Einkaufsoptionen, wie z. B. camping, camping- produkte, zelt wählen, bevor Sie sich endgültig für Ihre Bezugsquelle entscheiden. Den passenden Sportartikellieferanten zu finden, kann einen großen Unterschied für Ihren zukünftigen Geschäftserfolg ausmachen.
Schnellproduktverzeichnis