Startseite » Sport und Erholung » Schlafsack » Beutel nach unten
Schnellproduktverzeichnis Schnelllieferantenverzeichnis
Seite 350/2888  
Insgesamt 86627 Produkte von etwa 2887

Beutel nach unten

Hersteller & Lieferanten
China-Lieferant - Gold-Mitglied Lizenz Verifizierte Lieferant
Sortieren nach: Relevanz
Zeigen: 30 artikel

HandelsInflatable Climbing Wall für Sport Game (CHSP152)

Einheitspreis: US $ 2600 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:CHSP152
Passend für:KinderErwachsene
Material:PVC
Warenzeichen:Channal or OEM
Verpackung:PVC Bag for Product and Carton for Blower
Standard:CE/UL/SGS/EN14960

Pyramide Inflatable Climbing Wall für Adult oder Kid

Einheitspreis: US $ 2600 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:chsp402-2
Passend für:KinderErwachsene
Material:PVC
Warenzeichen:Channal or OEM
Verpackung:PVC Bag for Product and Carton for Blower
Standard:CE/UL/SGS/EN14960

2016 heißes Excited Outdoor Inflatable Rock Climbing Wall für Sale

Einheitspreis: US $ 1000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:chsp305
Passend für:KinderErwachsene
Material:PVC
Warenzeichen:Channal or OEM
Verpackung:PVC Bag for Product and Carton for Blower
Standard:CE/UL/SGS/EN14960

Aufblasbarer Fußballplatz, Inflatable Soap Fußballplatz (chsp114)

Einheitspreis: US $ 1000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:chsp114
Material:PVC
Alter:3-12 Jahre
Passend für:Freizeitpark
Art:Outdoor Playground
Kundenspezifische:Kundenspezifische

Verpackungs-Werbungs-Papierkasten (FP7032)

Einheitspreis: US $ 0.28-0.4 / Stück
MOQ: 2000 Stück
Handelsbedingungen: FOB, CFR, CIF, FAS, DDP, DAP, CIP, CPT, FCA, EXW

Modell Nr.:FP7032
Anwendung:Lebensmittel,Haushalt,Elektronisch,KosmetikaKleider
Material:Papier
Drucken Page:Single
Gewicht:280
Design-Trends:Individualisierung

Shanghai Forest Packing Co., Ltd.

[Provinz: Shanghai, China]

Anbieter Lieferant

Faltbarer kundenspezifischer Verpackungs-Papierkasten (FP7042)

Einheitspreis: US $ 0.3-0.5 / Stück
MOQ: 1000 Stück
Handelsbedingungen: FOB, CFR, CIF, FAS, DDP, DAP, CIP, CPT, FCA, EXW

Modell Nr.:FP7042
Material:Wellpappe
Versiegelungsgrad:Koffer
Feature:Gefaltete
Form Classification:Honeycomb Verpackung Box
Größe:Mittelgroße Box

Shanghai Forest Packing Co., Ltd.

[Provinz: Shanghai, China]

Anbieter Lieferant

Querstreifen SpitzenOpenning gewölbter Kasten FP248

Einheitspreis: US $ 0.3-0.5 / Stück
MOQ: 1000 Stück
Handelsbedingungen: FOB

Modell Nr.:FP248
Anwendung:Haushalt
Material:Schichtwerkstoff
Drucken Page:Single
Art:Hang Papier
Gewicht:300

Shanghai Forest Packing Co., Ltd.

[Provinz: Shanghai, China]

Anbieter Lieferant

Wellpappen-Archiv-Kasten für schwere Speicherung

Einheitspreis: US $ 0.39-0.6 / Stück
MOQ: 1000 Stück
Handelsbedingungen: FOB, CFR, CIF, FAS, DDP, DAP, CIP, CPT, FCA, EXW

Modell Nr.:FP7074
Material:Papier
Art:Box
Größe:Groß
Wasserdicht:Nicht wasserdicht
Härte:Teilfest

Shanghai Forest Packing Co., Ltd.

[Provinz: Shanghai, China]

Anbieter Lieferant

Platte der Fabrik-Preis Paypal Zahlungs-U (GC-M015)

Einheitspreis: US $ 1.0-3.0 / Stück
MOQ: 10 Stück
Handelsbedingungen: FOB, CIF, EXW

Modell Nr.:GC-M015
Schnittstellen Typ:USB 2.0
Form:Kleben
Material:Metall
Open Style:Gleitend
USB Typ:Gemeinsame USB Disk

Shenzhen Gold Cost Technology Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Qualitäts-Spritze-Chirurg USB-Blinken-Laufwerk (GC-S006)

Einheitspreis: US $ 1.0-3.0 / Stück
MOQ: 10 Stück
Handelsbedingungen: FOB, EXW, CIF

Modell Nr.:GC-S006
Schnittstellen Typ:USB 2.0
Form:Kleben
Material:Kunststoff
Open Style:Dach
USB Typ:Kreative USB Disk

Shenzhen Gold Cost Technology Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Voller Capacity New Pizza USB 8GB (GC-P111)

Einheitspreis: US $ 1.0-3.0 / Stück
MOQ: 10 Stück
Handelsbedingungen: FOB, EXW, CIF

Modell Nr.:GC-P111
Schnittstellen Typ:USB 2.0
Open Style:Dach
Material:PVC
Form:Kleben
Warenzeichen:oem

Shenzhen Gold Cost Technology Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Kreditkarte USB 2.0/3.0 (GC-P113)

Einheitspreis: US $ 1.0-3.0 / Stück
MOQ: 10 Stück
Handelsbedingungen: FOB, EXW, CIF

Modell Nr.:GC-P113
Speicherkapazität:≤ 1G
Schnittstellen Typ:USB 2.0
Form:Karte
Material:Kunststoff
Open Style:Öffnen

Shenzhen Gold Cost Technology Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Schmucksache-Geschenk USB-Armband - Schmucksachen USB-Blinken-Laufwerk (GC-790)

Einheitspreis: US $ 1.0-3.0 / Stück
MOQ: 10 Stück
Handelsbedingungen: FOB, CIF, EXW

Modell Nr.:GC-790
Speicherkapazität:≤ 1G
Schnittstellen Typ:USB 2.0
Material:Schmuck / Diamond
Open Style:Öffnen
USB Typ:Kreative USB Disk

Shenzhen Gold Cost Technology Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Hohe Leistungsfähigkeits-Shanghai-handliches Zahn-Darstellung-Systems-Digital-zahnmedizinischer ...

Einheitspreis: US $ 1700.0-3700.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: EXW

Modell Nr.:MXS-3
Klassifikation:Imaging Diagnostic Equipment
Art:X Ray Equipment
Bescheinigung:CE
Warenzeichen:Handy
Verpackung:Carton/Plastic/Foam

Mident Industrial Co., Ltd.

[Provinz: Henan, China]

Anbieter Lieferant

Sojabohnenöl zerkleinern den Protein-Extruder, der Maschinen herstellt

Einheitspreis: US $ 15000 / Set
MOQ: 1 Set

Modell Nr.:KLD - Soya Mince Protein Extruder Making Machines
Bescheinigung:CEISO 9001
Energiequelle:Elektro
Verarbeiten:Thermal Processing
Automatischer Grad:Automatische
Kundenspezifische:Kundenspezifische

Jinan Kelid Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

Heißer galvanisierter automatischer Huhn-Rahmen für wachsende Bratroste und Schichten (A3L90)

Einheitspreis: US $ 80 / Set
MOQ: 50 Sets
Handelsbedingungen: FOB, EXW

Modell Nr.:A3L90
Energiequelle:Elektrisch
Warenzeichen:SILVER STAR
Verpackung:105 Set Per 20ft Container
Standard:1.95*2.35*1.5M
Herkunft:Taikang, Zhoukou

Jungfrau-brasilianische Spitze-Vorderseite-Perücke

Einheitspreis: US $ 60.0-180.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CIF

Material:Human Hair
Stil:Wellig
Passend für:Frauen
Länge:Lange
Haar-Grad:Remy Hair
Farbe:Schwarz

Qingdao Bond Arts & Crafts Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

Farben-wellenförmige volle Spitze-Perücke des Ton-zwei

Einheitspreis: US $ 60.0-180.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CIF

Material:Human Hair
Stil:Wellig
Passend für:Frauen
Länge:Lange
Haar-Grad:Remy Hair
Farbe:Braun

Qingdao Bond Arts & Crafts Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

Breathable Baby-Hosen, Zug keucht Windel

Einheitspreis: US $ 0.06-0.12 / Stück
MOQ: 1 *40'HQ
Handelsbedingungen: FOB

Modell Nr.:JL16-005
Art:Wegwerfwindel
Anti-Leak:3D Leak Prevention-Kanal
Absorption:Atmungsaktive Soft
Material:Non-Woven
Feature:Gedruckt,Plain Woven,BestickteJacquard

Qualität Effictive Waschpulver/Papierkasten-Verpackungs-Wäscherei-Reinigungsmittel-Puder

Einheitspreis: US $ 350.0-700.0 / Ton
MOQ: 1 Ton
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:CX-16
Warenzeichen:OEM
Verpackung:From 15g to 10kg
Standard:SGS
Herkunft:China
HS-Code:34022010

Reinigendes waschendes Wäscherei-Puder säubern

Einheitspreis: US $ 350.0-700.0 / Ton
MOQ: 1 Ton
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:CX-22
Warenzeichen:OEM
Verpackung:From 15g to 10kg
Standard:SGS
Herkunft:China
HS-Code:34022010

Frische Geruch-Wäscherei, die reinigendes Puder wäscht

Einheitspreis: US $ 350.0-700.0 / Ton
MOQ: 1 Ton
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:CX-24
Warenzeichen:OEM
Verpackung:From 15g to 10kg
Standard:SGS
Herkunft:China
HS-Code:34022010

Tee-Puder-Verpackmaschine

Einheitspreis: US $ 1.0-99999.0 / Set
MOQ: 1 Set

Modell Nr.:AP-200BP
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,MilchprodukteReismehl
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:BildungFüllung

Guangzhou Autopaking Machinery Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Vertikale Puder-Verpackungsmaschine

Einheitspreis: US $ 1.0-99999.0 / Set
MOQ: 1 Set

Modell Nr.:AP-200BP
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,MilchprodukteReismehl
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:BildungFüllung

Guangzhou Autopaking Machinery Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Tomatensauce-flüssige Verpackmaschine

Einheitspreis: US $ 1.0-99999.0 / Set
MOQ: 1 Set

Modell Nr.:AP-200BL
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care ProdukteÖl
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:BildungFüllung

Guangzhou Autopaking Machinery Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Heiße Soße Fill&Packing Maschine

Einheitspreis: US $ 1.0-99999.0 / Set
MOQ: 1 Set

Modell Nr.:AP-200BL
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care ProdukteÖl
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:BildungFüllung

Guangzhou Autopaking Machinery Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

/Juice-Verpackmaschine des Öls 1000ml

Einheitspreis: US $ 1.0-99999.0 / Set
MOQ: 1 Set

Modell Nr.:AP-200BL
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care ProdukteÖl
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:BildungFüllung

Guangzhou Autopaking Machinery Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Verpackmaschine des reinen Wasser-1000ml

Einheitspreis: US $ 1.0-99999.0 / Set
MOQ: 1 Set

Modell Nr.:AP-200BL
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care ProdukteÖl
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:BildungFüllung

Guangzhou Autopaking Machinery Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Körnchen /Salt, das &Packing Maschine füllt

Einheitspreis: US $ 1.0-99999.0 / Set
MOQ: 1 Set

Modell Nr.:AP-200BV
Automatischer Grad:Automatisch
Anwendung:Milchprodukte,Tee,SnackReismehl
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Guangzhou Autopaking Machinery Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

18 Kopf-Wäger Combitnation mit Hochgeschwindigkeitsverpackmaschine

Einheitspreis: US $ 1.0-99999.0 / Set
MOQ: 1 Set

Modell Nr.:AP-42120BG
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Milchprodukte,Tee,SnackReismehl
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:BildungFüllung

Guangzhou Autopaking Machinery Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Brauchen Sie Hilfe?
Kontaktieren Sie bitte uns.
Verwandte Schnellsuche Kategorien
Wir bieten Ihnen ein komplettes Sortiment an Sportwaren und Sportausrüstung für Ihre gesamte Sportartikelnachfrage. Unsere chinesischen Lieferanten verfügen über den größten Bestand an qualitativen Sportartikeln, Jagd-, Angel- und Campingausrüstungen. Erfahren Sie mehr über die neuesten Nachrichten von der Sportartikelindustrie in unserem Handelsressourcencenter. Unser ausgezeichneter Einkäuferservice freut sich, Ihnen beim Auffinden von schwer erhältlichen Artikeln der Freizeitindustrie zu helfen. Es gibt eine Vielzahl von Sport- und Freizeitartikeln auf unserer Webseite, einschließlich obige Beutel Nach Unten, und Sie können zwischen anderen Einkaufsoptionen, wie z. B. camping, camping- produkte, zelt wählen, bevor Sie sich endgültig für Ihre Bezugsquelle entscheiden. Den passenden Sportartikellieferanten zu finden, kann einen großen Unterschied für Ihren zukünftigen Geschäftserfolg ausmachen.
Schnellproduktverzeichnis