Startseite » Sport und Erholung » Schlafsack » Beutel nach unten
Schnellproduktverzeichnis Schnelllieferantenverzeichnis
Seite 377/2996  
Insgesamt 89866 Produkte von etwa 3328

Beutel nach unten

Hersteller & Lieferanten
China-Lieferant - Gold-Mitglied Lizenz Verifizierte Lieferant
Sortieren nach: Relevanz
Zeigen: 30 artikel

Vakuumbeutel-Verpackungsmaschine für Verkauf

Einheitspreis: US $ 6000.0-99999.0 / Stück
MOQ: 1 Stück

Modell Nr.:GY-6
Automatischer Grad:Automatisch
Anwendung:Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Öl,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Und Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:FüllungDichtung

Shanghai Genyond Technology Co., Ltd.

[Provinz: Shanghai, China]

Anbieter Lieferant

Zutreffendes feuchtigkeitsfestes Felsen-Papier keine hölzerne Masse

Einheitspreis: US $ 1100.0-1200.0 / Ton
MOQ: 1 Ton

Verwendung:Lebensmittel Wrapping Paper,Filter Paper,PauspapierGeschenkpapier
Feature:Wasserdicht,Fettdicht,Fire-Proof,Rostfrei,Antistatisch,Anti-CurlMoisture Proof
Art:Spezialpapier
Beschichtungsseite:Double Side
Pulp Stil:Recycelt
Warenzeichen:stone paper

Shenzhen Stone Paper Enterprise Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Shrink-Verpackungsmaschine-Schrumpfverpackung-Maschine

Einheitspreis: US $ 6000.0-8000.0 / Set
MOQ: 1 Set

Modell Nr.:BS-400LA + BMD-450C
Anwendung:Lebensmittel,Ware,Machinery & Hardware,Textil-,Alkohol und Tabak,Spielzeug,Chemikalie,Kleider,Geschenke & Arts,Speise-Medizinisch
Verpackung:Film
Automatischer Grad:Automatisch
Driven Typ:Elektrisch
Art und Weise der Verpackung:Vierseitendichtungstyp

Schrumpfverpackung-Maschineshrink-Verpackungs-Maschine

Einheitspreis: US $ 10000.0-13000.0 / Set
MOQ: 1 Set

Modell Nr.:GB-350
Anwendung:Lebensmittel,Ware,Machinery & Hardware,Textil-,Alkohol und Tabak,Spielzeug,Chemikalie,Kleider,Geschenke & ArtsMedizinisch
Verpackung:Film
Automatischer Grad:Automatisch
Driven Typ:Elektrisch
Art und Weise der Verpackung:Vierseitendichtungstyp

Verpackungsmaschine-Verpackmaschine-Verpackungs-Maschine

Einheitspreis: US $ 9000.0-11000.0 / Set
MOQ: 1 Set

Modell Nr.:BMD-800A
Anwendung:Lebensmittel,Ware,Machinery & Hardware,Textil-,Alkohol und Tabak,Spielzeug,Chemikalie,Kleider,Geschenke & Arts,Speise-Medizinisch
Verpackung:Film
Automatischer Grad:Automatisch
Driven Typ:Elektrisch
Stellen Sie Schnell:Frequenzkonversion Speed ​​Regulation

Schädel formte USB-Blitz-Laufwerk/Karikatur Kurbelgehäuse-Belüftungusb-Speicher-Stock

Einheitspreis: US $ 2.55-8.15 / Stück
MOQ: 100 Stück

Speicherkapazität:Kundenspezifische
Schnittstellen Typ:USB 2.0 & USB 1.1
Material:Silikon
Open Style:Ziehen
USB Typ:Kreative USB Disk
Funktion:USB Disk Storage

Neue Produkte AluminiumVapioneer H3 Shisha Feder mit kreativem Entwurf

Einheitspreis: US $ 28.0-35.99 / Stück
MOQ: 1 Stück

Modell Nr.:Vapioneer H3 shisha pen
Einstellen:Single
Mechanische Mod:Non-Mechanical
Variable Voltage:Non-Variable Voltage
Variable Leistung:Non-Variable Leistung
Warenzeichen:vapioneer

2016 neue Entwurf Vapioneer H3 Huka Shisha mit Geschenk-Paket

Einheitspreis: US $ 28.0-35.99 / Stück
MOQ: 1 Stück

Modell Nr.:Vapioneer H3 hookah shisha
Einstellen:Single
Mechanische Mod:Non-Mechanical
Variable Voltage:Non-Variable Voltage
Variable Leistung:Non-Variable Leistung
Warenzeichen:vapioneer

Neue Produkte Vapioneer H3 elektronische Zigaretten-Huka-Großhandelsfeder

Einheitspreis: US $ 28.0-35.99 / Stück
MOQ: 1 Stück

Modell Nr.:Vapioneer H3
Einstellen:Single
Mechanische Mod:Non-Mechanical
Variable Voltage:Non-Variable Voltage
Variable Leistung:Non-Variable Leistung
Warenzeichen:vapioneer

2017 neue Produkt-nachladbare 18650 Batterie Vapioneer H3 Huka Shisha

Einheitspreis: US $ 28.0-35.99 / Stück
MOQ: 1 Stück

Modell Nr.:Vapioneer H3
Einstellen:Single
Mechanische Mod:Non-Mechanical
Variable Voltage:Non-Variable Voltage
Variable Leistung:Non-Variable Leistung
Warenzeichen:vapioneer

H20 Wooden Beam Wall Form und Column Formwork

Einheitspreis: US $ 1 / Square Meter
MOQ: 300 Quadratmeter

Modell Nr.:wall formwork
Stoff:Bauholz
Art:Wandschalung
Warenzeichen:HORIZON
Verpackung:Pallet
Standard:SGS

XINGTAI HORIZON FORMWORK CO., LTD.

[Provinz: Hebei, China]

Anbieter Lieferant

Justierbares Wall Formwork Easy zu Handle

Einheitspreis: US $ 1 / Square Meter
MOQ: 300 Quadratmeter

Modell Nr.:wall formwork
Stoff:Bauholz
Art:Wandschalung
Warenzeichen:HORIZON
Verpackung:Pallet
Standard:SGS

XINGTAI HORIZON FORMWORK CO., LTD.

[Provinz: Hebei, China]

Anbieter Lieferant

15mm Tie Rod mit Wing Nut für Wall Formwork

MOQ: 1000 Meter

Modell Nr.:tie rod
Anwendung:Schmuck
Bescheinigung:SGS
Oberflächenbehandlung:Nein
Material:Stahl
Warenzeichen:HORIZON

XINGTAI HORIZON FORMWORK CO., LTD.

[Provinz: Hebei, China]

Anbieter Lieferant

Teleskopstahlstütze für Deckenschalungen Bau

Einheitspreis: US $ 1 / Stück
MOQ: 1000 Stück
Handelsbedingungen: FOB, CIF

Modell Nr.:HZP Prop
Material:Stahl
Art:Behoben
Unterstützmodus:Bodentyp Gerüste
Läppen Formular:Vollständige Gerüste
Erection Position:Externe Gerüste

XINGTAI HORIZON FORMWORK CO., LTD.

[Provinz: Hebei, China]

Anbieter Lieferant

Heißer Verkauf moderner lederner Eames Büro-Stuhl (SZ-OC128)

MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, EXW

Modell Nr.:SZ-OC128
Armlehne:Mit Armlehne
Stil:Moderne
Material:Kunstleder
Rotierend:Rotierend
Gefaltet:Entfaltete

Foshan Sun Gold Furniture Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Heißer Verkaufs-moderner Ineinander greifen-Gewebe-Büropersonal-Stuhl (SZ-OC163)

MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, EXW

Modell Nr.:SZ-OC163
Gefaltet:Entfaltete
Material:Glas
Armlehne:Mit Armlehne
Stil:Moderne
Rotierend:Rotierend

Foshan Sun Gold Furniture Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Heißer Verkaufs-moderner mittlerer rückseitiges Leder-Büro Eames Stuhl (SZ-OC128)

MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, EXW

Modell Nr.:SZ-OC128
Armlehne:Mit Armlehne
Stil:Moderne
Material:Kunstleder
Rotierend:Rotierend
Gefaltet:Entfaltete

Foshan Sun Gold Furniture Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Anionische PAM für Wastewater Treatment

Einheitspreis: US $ 1800.0-2000.0 / Ton
MOQ: 1 Ton
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:BLUFLOC
Warenzeichen:bluwat
Verpackung:25kg PE or Kraft Paper Bag
Standard:SGS
Herkunft:China
HS-Code:39069010

Yixing Bluwat Chemicals Co., Ltd.

[Provinz: Jiangsu, China]

Anbieter Lieferant

5 Tonnen Tube Ice Machine Used in Hotels, Restaurants

Einheitspreis: US $ 1 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:TV50
Eisherstellung:Fließend
Kühl Way:Wassergekühlte
Automatisierung:Automatisierung
Geräteaufbau:Integral
Maschinen-Größe:Groß

Guangzhou Koller R & E Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Weißes Fire Fiberglass Cloth für Fire Control

Einheitspreis: US $ 2.0-10.0 / Metro
MOQ: 100 Meter
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:FB-005
Material:Fiberglas
Feuerfeste Endurance Rating:A Grade
Bescheinigung:GB8624-2006,EN 1869: 1997,CESGS
Oberflächenbehandlung:Ohne Silikon beschichtet
Asbest Löschdecke Type:Staubfrei

Hersteller-Hochgeschwindigkeitsplastikfilm-durchbrennenmaschine

Einheitspreis: US $ 20000.0-25000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DAT, FAS, CIP, CPT, FCA, EXW

Modell Nr.:QS-AH50/55/60/65
Art:PE Film Blowing Machine
Rohstoff:PE
Maximale Folding Breite Film:1200mm
Schneckendurchmesser:50mm
Automatisierung:Automatisch

Ruian Queensense Machine Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

3 Tonnen/Tag Einfach-Betriebsgefäß-Eis-Maschine (TV30)

Einheitspreis: US $ 10000 / Set
MOQ: 1 Set

Modell Nr.:TV30
Eisherstellung:Fließend
Kühl Way:Wassergekühlte
Automatisierung:Automatisierung
Geräteaufbau:Teilt
Maschinen-Größe:Groß

Guangzhou Koller R & E Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

3tons Nahrung-Grade Commercial Tube Ice Making Machine für Hotels/Restaurants/Bars

Einheitspreis: US $ 10000 / Set
MOQ: 1 Set

Modell Nr.:TV30
Eisherstellung:Fließend
Kühl Way:Wassergekühlte
Automatisierung:Automatisierung
Geräteaufbau:Teilt
Maschinen-Größe:Groß

Guangzhou Koller R & E Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Gesundheitliches Tube Ice Machine Hochleistungs- Low Powe Comsuption 3tons/Day

Einheitspreis: US $ 10000 / Set
MOQ: 1 Set

Modell Nr.:TV30
Eisherstellung:Fließend
Kühl Way:Wassergekühlte
Automatisierung:Automatisierung
Geräteaufbau:Teilt
Maschinen-Größe:Groß

Guangzhou Koller R & E Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Gefäß Ice Machine Under PLC Automatic Controller 3000kg/Day (TV30)

Einheitspreis: US $ 10000 / Set
MOQ: 1 Set

Modell Nr.:TV30
Eisherstellung:Fließend
Kühl Way:Wassergekühlte
Automatisierung:Automatisierung
Geräteaufbau:Teilt
Maschinen-Größe:Groß

Guangzhou Koller R & E Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

3 Tonnen Cer-anerkannte Gefäß-Eis-Maschinen-

Einheitspreis: US $ 10000 / Set
MOQ: 1 Set

Modell Nr.:TV30
Eisherstellung:Fließend
Kühl Way:Wassergekühlte
Automatisierung:Automatisierung
Geräteaufbau:Teilt
Maschinen-Größe:Groß

Guangzhou Koller R & E Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

3.0mm Fiberglass Plain Woven Fabric für Insulation

Einheitspreis: US $ 1.0-3.0 / Metro
MOQ: 500 Meter

Bescheinigung:CEICH SO
Anwendung:Fiberglass Mesh Stoff
Gewebeart:Plain Woven
Fiberglas Art:E-Glas
Alkaligehalt:Medium
Warenzeichen:GB. OPT

Automatische Sojabohnenölvegan-Protein-Extruder-Maschine

Einheitspreis: US $ 15000 / Set
MOQ: 1 Set

Modell Nr.:KLD - soya vegan protein extruder machine
Bescheinigung:CEISO 9001
Energiequelle:Elektro
Verarbeiten:Thermal Processing
Automatischer Grad:Automatische
Kundenspezifische:Kundenspezifische

Jinan Kelid Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

China-Hersteller-Ladeplatten-Verpackungs-China-Ausdehnungs-Verpackung

Einheitspreis: US $ 5000.0-50000.0 / Stück
MOQ: 1 Stück

Modell Nr.:TOPW-1500
Verpackungsart:Cartons
Art:Automatische Verpackungsmaschine
Driven Type:Elektrisch
Anwendung:Kosmetika
Automatischer Grad:Automatisch

Automatische Wärme-Schrumpfung, die Verpackungsmaschine einwickelt

Einheitspreis: US $ 6000.0-8000.0 / Set
MOQ: 1 Set

Modell Nr.:BS-400LA+BMD-450C
Anwendung:Lebensmittel,Ware,Machinery & Hardware,Textil-,Alkohol und Tabak,Spielzeug,Chemikalie,Kleider,Geschenke & Arts,Speise-Medizinisch
Verpackung:Film
Automatischer Grad:Automatisch
Driven Typ:Elektrisch
Art und Weise der Verpackung:Vierseitendichtungstyp
Brauchen Sie Hilfe?
Kontaktieren Sie bitte uns.
Verwandte Schnellsuche Kategorien
Wir bieten Ihnen ein komplettes Sortiment an Sportwaren und Sportausrüstung für Ihre gesamte Sportartikelnachfrage. Unsere chinesischen Lieferanten verfügen über den größten Bestand an qualitativen Sportartikeln, Jagd-, Angel- und Campingausrüstungen. Erfahren Sie mehr über die neuesten Nachrichten von der Sportartikelindustrie in unserem Handelsressourcencenter. Unser ausgezeichneter Einkäuferservice freut sich, Ihnen beim Auffinden von schwer erhältlichen Artikeln der Freizeitindustrie zu helfen. Es gibt eine Vielzahl von Sport- und Freizeitartikeln auf unserer Webseite, einschließlich obige Beutel Nach Unten fabrik, und Sie können zwischen anderen Einkaufsoptionen, wie z. B. camping, camping- produkte, zelt wählen, bevor Sie sich endgültig für Ihre Bezugsquelle entscheiden. Den passenden Sportartikellieferanten zu finden, kann einen großen Unterschied für Ihren zukünftigen Geschäftserfolg ausmachen.
Schnellproduktverzeichnis