Startseite » Landwirtschaft & Essen » Getreide und Korn » Mehl Lebensmittel
Schnellproduktverzeichnis Schnelllieferantenverzeichnis
Seite 10/1858  
Insgesamt 55739 Produkte von etwa 3981

Mehl Lebensmittel

Hersteller & Lieferanten
China-Lieferant - Gold-Mitglied
Sortieren nach: Relevanz
Zeigen: 30 artikel

Sinobake Massenkugel-Form-Plätzchen, Minibiskuite mit Kartoffel-Vitaminen

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 9.88-16.88 / Box
MOQ: 30 Boxen

Modell Nr.:MPB001
Haltbarkeit:> 12 Monate
Anwendung:Alter Mann,ErwachseneKinder
Art:Keks
Warenzeichen:SINOBAKE
Verpackung:Cartons

Jiangmen Sinobake Food Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Mischmaschine-/Powder-Mischer-Maschine für Tierfutter-Salz- und ...

Einheitspreis: US $ 3000.0-10000.0 / Stück
MOQ: 1 Stück

Modell Nr.:HGD-6000
Mischer Typ:Powder Mixer
Arbeits:High Speed ​​Mixer
Rühren Type:Spirale
Anwendung:PulverGranulat
Bescheinigung:CEISO

Shanghai Chuanchu Industrial Co., Ltd.

[Provinz: Shanghai, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Pistazie, Zucker, Apple schneidet Verpackungsmaschine (VFFS)

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 3500.0-10000.0 / Stück
MOQ: 1 Stück

Modell Nr.:MD-K420
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Und Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

China SME Group Co., Ltd.

[Provinz: Shanghai, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Mit mittlerer Kapazität Kekserzeugung-Maschine/Biskuit maschinell hergestellt in China

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 200000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CIF

Modell Nr.:SH-280, SH-400, SH-600, SH-800, SH-1000, SH-1200,
Bescheinigung:CEISO 9001
Energiequelle:Gas
Automatischer Grad:Automatische
Anwendung:Keks
Kundenspezifische:Kundenspezifische

Hölzerne Holzkohle-Packpapier-Beutel, BBQ-Holzkohle-verpackender Papierbeutel

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 0.13-0.16 / Stück
MOQ: 5000 Stück
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:TY-CB001
Anwendung:Förderung,Haushalt,ChemikalieKleider
Feature:Moisture Proof,Recycelbar,Biologisch abbaubar,Wegwerf-,Shock ResistanceAntistatisch
Material:Papier
Form:Quadrat Bodenbeutel
Bag Variety:Ihre Tasche

Tianyu Packaging Products Co., Ltd.

[Provinz: Shanghai, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Hanlu 2017 Hülsen-Verpackungshrink-Maschine (BZJ5038B u. BSE5040A)

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 2850.0-2950.0 / SET
MOQ: 1 SET

Modell Nr.:BZJ5038B & BSE5040A
Verpackungsart:Flaschen
Driven Type:Elektrisch
Anwendung:Getränke,Skin Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,ReismehlGewürz
Automatischer Grad:Automatisch
Inclusion Degree:Halbwickelmaschine

WENZHOU HANLU MACHINERY CO., LTD.

[Provinz: Zhejiang, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Industrielle Corn- FlakesFrühstückskost- aus Getreidemaschine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 1000 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:Corn Flakes/Breakfast Cereals Production Machine
Kundenspezifische:Kundenspezifische
Bescheinigung:CEISO 9001
Energiequelle:Elektro
Automatischer Grad:Automatische
Warenzeichen:SBN

Edelstahl-kollodiales Tausendstel für Erdnussbutter-/Sesam-Schleifer-Maschine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 400.0-2500.0 / Stück
MOQ: 1 Stück

Modell Nr.:JM
Art:Flour Mill
Anwendung:MehlBohnen
Aussehen:Vertikal
Pressematerial:Erdnuss
Press Series:Zweite

Guangzhou Hundom Technology Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

10kg 25kg 50kg Reis-Zuckermehl-pp. gesponnener Beutel

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 0.01-1.0 / Stück
MOQ: 10000 Stück

Modell Nr.:JC-B030
Anwendung:Lebensmittel,Förderung,HaushaltChemikalie
Feature:Moisture Proof,RecycelbarWegwerf-
Material:PP
Form:Plastiktaschen
Prozess:Plastic Packaging Taschen

Fisch-Nahrungsmittelaufbereitende Zeile/Wels-Zufuhr-Tablette, die Maschine herstellt

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 10000.0-60000.0 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:SLG85
Energiequelle:Elektro
Verarbeiten:Mild Verarbeitung
Automatischer Grad:Automatische
Anwendung:Hund,Fisch,KatzeVogel
Einzugstyp:Fischmehl

Jinan Datong Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Gebratene Mehl-Imbiss-Nahrungsmittelknusperige Chip-Extruder-Maschinen-Prozesszeile

Einheitspreis: US $ 8000 / Stück
MOQ: 1 Stück

Modell Nr.:SLG65-C, SLG65-D, SLG70-C
Bescheinigung:CEISO 9001
Energiequelle:Elektro
Verarbeiten:Thermal Processing
Automatischer Grad:Automatische
Anwendung:Pommes frites

Jinan Dayi Extrusion Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Automatischer Beutel-Drehverpackungsmaschine für Flüssigkeit (FA6-8-200L)

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 10000.0-50000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, CIP, EXW

Modell Nr.:FA6-8-200L
Automatischer Grad:Automatisch
Anwendung:KosmetikaGetränke
Art:Und Verschließmaschine
Driven Type:Pneumatisch
Warenzeichen:FABLE

Wenzhou Fable Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Gelbe Protein-Zufuhr-Zusätze der Maisglutin-Mahlzeit-60% für Verkauf

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 400.0-450.0 / Ton
MOQ: 20 Tonnen
Handelsbedingungen: FOB, CFR, CIF, DAT, FAS, DDP, DAP, CIP, CPT, FCA, EXW

Modell Nr.:60%
Main Ingredient:Protein
Art:Keeping Gesundheit und Wachstum fördern
Form:Powder-Feed
Hauptnährstoffe:Functional-Feed
Warenzeichen:deda

Wudi Deda Agriculture Co., Limited

[Provinz: Shandong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Voller automatischer Nudel-Teigwaren-Isolationsschlauch, der Verpackungsmaschine wiegt

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 5000.0-38000.0 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, EXW, CIF

Modell Nr.:BJWD450/132 NHPB-III
Automatischer Grad:Automatisch
Anwendung:Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Qingdao HKJ Packaging Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Automatische wiegende und Verpackungsmaschine Vertikale Xfl-200

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 30000.0-40000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:XFL-200
Automatischer Grad:Automatisch
Anwendung:SnackReismehl
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Automatisches Korn, das füllende Dichtungs-Nahrungsmittelverpackungsmaschine (2016, wiegt neu)

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 20000.0-50000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CIF

Modell Nr.:RZ6/8-200/300A
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Und Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:FüllungDichtung

Ruian Unionpack International Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Automatische vertikale Puder-Verpackungsmaschine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 15000.0-25000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:DXD-520F
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,ReismehlGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Ruian Haicheng Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Nahrung- für Haustierezucht- Hundenahrung

Modell Nr.:FB-007
Art:Pet Hauptfutter
Spezies:Hund
Anwendung:Adult PetPuppy Pet
Aussehen:Trocken
Feature:All Natural

Shanghai Fubei Pet Food Co., Ltd.

[Provinz: Shanghai, China]

Sich hin- und herbewegende Fisch-Zufuhr-Maschinen-Aquarium-Fisch-Nahrungsmitteltausendstel-Maschine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 10000.0-40000.0 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:SLG85
Energiequelle:Elektro
Verarbeiten:Mild Verarbeitung
Automatischer Grad:Automatische
Anwendung:Hund,Fisch,KatzeVogel
Einzugstyp:Fischmehl

Jinan Datong Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Volles automatisches wiegendes kleine Süßigkeit-Reis-Bohnen-Nuts Sonnenblumensamen-Popcorn bricht ...

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 15000.0-25860.0 / Stück
MOQ: 1 Stück

Modell Nr.:LD-520A
Automatischer Grad:Automatisch
Anwendung:Milchprodukte,Gemüse Obst,SnackReismehl
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

FOSHAN LAND PACKAGING MACHINERY CO., LTD.

[Provinz: Guangdong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Milch und Rice Plus Preventing Dropping Hair Cat Food

Art:Pet Pflegen & Health Products
Spezies:Hund
Anwendung:Adult PetPuppy Pet
Aussehen:Trocken
Feature:All Natural
Spec:0-99g

Hebei Shouen Trade Co., Ltd

[Provinz: Hebei, China]

Automatische Flüssigkeit, die füllende Dichtungs-Nahrungsmittelverpackungsmaschine für ...

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 20000.0-50000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CIF

Modell Nr.:RZ6/8-200/300A
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Und Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:FüllungDichtung

Ruian Unionpack International Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Automatische DrehHochgeschwindigkeitsverpackmaschine für Puder-Flüssigkeit-Körnchen

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 30000.0-40000.0 / Set
MOQ: 1 Set

Modell Nr.:MR8-200RH
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Getränke,Milchprodukte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Und Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:FüllungDichtung

Hangzhou Merry Sino Technology Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Vollautomatischer Imbiß, Muttern, Körnchen, Nahrungsmittelquetschkissen-Beutel, der die füllende ...

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 6500.0-48000.0 / Sets
MOQ: 1 Sets

Modell Nr.:RL420
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Tee,Gemüse Obst,Snack,ReismehlGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Automatische vertikale Formen/Füllen/Versiegelnzuckerverpackungsmaschine 420A

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 9500.0-10000.0 / Set
MOQ: 1 Set

Modell Nr.:DXD-420A
Automatischer Grad:Automatisch
Anwendung:Milchprodukte,SnackReismehl
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Ruian Haicheng Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Neue gute geschmeckte dänische Butterplätzchen

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 15.0-18.0 / Box
MOQ: 30 Boxen

Modell Nr.:BC002
Haltbarkeit:> 12 Monate
Anwendung:Alter Mann,ErwachseneKinder
Art:Keks
Warenzeichen:SINOBAKE
Verpackung:Cartons

Jiangmen Sinobake Food Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Gelbwurz-Puder-Paprika-Puder-Kraut-Puder-Protein-Puder-Kaffee-Puder-reinigende ...

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 16000.0-22000.0 / Set
MOQ: 1 Set

Modell Nr.:HTL-420F
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Tee,Gemüse Obst,Snack,ReismehlGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Ruian Honetop Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Automatische trinkende Flasche Kurbelgehäuse-Belüftungshrink-Hülsen-Etikettiermaschine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 12000.0-14500.0 / Set
MOQ: 1 Set

Modell Nr.:PM-150
Automatischer Grad:Automatisch
Anwendung:Kosmetika,Getränke,Reinigung, Reinigungsmittel,Skin Care Produkte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,Reismehl,GewürzMilchprodukte
Art:Sleeve Etikettiermaschine
Driven Type:Elektrisch
Klassifikation:Automatische vertikale runde Flaschen-Etikettiermaschine

Tierfisch-Zufuhr, die Nahrung- für Haustieretabletten-Tausendstel-Extruder-Maschine herstellt

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 2160 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:WS
Art:Pellet Mill
Verarbeitungsobjekt:Animal-Derived-Feed
Verarbeitung Technics:Crushing-before-Mixing
Siebgewebe:Mit Siebgewebe
Zerkleinerungsgeräte Typ:Feed-Hammermühle

Golden Machinery Equipment Co., Ltd.

[Provinz: Henan, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Pp. gesponnener Beutel für Reis, Weizen-Mehl, Zucker, Düngemittel, Futter

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 0.08-0.19 / Stück
MOQ: 5000 Stück

Modell Nr.:RI
Anwendung:Lebensmittel,ChemikalieKleider
Feature:Moisture Proof,Recycelbar,Biologisch abbaubar,Wegwerf-,Shock ResistanceAntistatisch
Material:PP
Form:Plastiktaschen
Prozess:Plastic Packaging Taschen

Qingdao Sanrun Packing Products Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com
Brauchen Sie Hilfe?
Kontaktieren Sie bitte uns.
Verwandte Schnellsuche Kategorien
Durchsuchen Sie unsere SGS geprüfte Datenbank von Agrar-Zulieferern und setzen Sie sich mit den besten Lebensmittel-Profis in Verbindung, die jede Ihre Nachfrage decken können. Finden Sie heraus, welche Auswirkung ein Qualitätsanbieter von Obst & Gemüse auf Ihre zukünftige Geschäftsentwicklung haben kann. Wir dienen als umfassende Quelle von Agrar- & Lebensmittelherstellern quer durch China, und hier ist die Liste der Bezugsquellen / Hersteller, die mit Ihrer Produktsuche nach Mehl Lebensmittel fabrik übereinstimmen. Importeure wie Sie können großartige Angebote zu Fabrikpreisen für maschinen für die nahrungs, lebensmittel- maschine, nahrungsmittelmaschinen erhalten. Gemüsegroßhändler, Obstlieferanten, Exporteure von Milchprodukten, Nahrungsmittelhersteller, ungeachtet welche Lebensmittelexporteure in China Sie benötigen, hier werden Sie fündig. Nehmen Sie direkten Kontakt auf & erhalten Sie Preisangebote in Echtzeit!
Schnellproduktverzeichnis