Startseite » Landwirtschaft & Essen » Extrakt Aus Tier und Pflanze » Mehl Lebensmittel
Schnellproduktverzeichnis Schnelllieferantenverzeichnis
Seite 146/1462  
Insgesamt 43856 Produkte von etwa 1624

Mehl Lebensmittel

Hersteller & Lieferanten
China-Lieferant - Gold-Mitglied
Sortieren nach: Relevanz
Zeigen: 30 artikel

Dxd-F vertikale Puder-Selbstverpackungsmaschine

Einheitspreis: US $ 1.0-10000.0 / Stück
MOQ: 1 Stück

Modell Nr.:DXD-F
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Tee,Gemüse Obst,SnackReismehl
Art:Und Verschließmaschine
Enden Spezies:Flaschenformungs
Bildungsfunktion:Füllung

Beweglicher Laser-Staub-Konzentrations-Detektor

Einheitspreis: US $ 2000.0-10000.0 / Stück
MOQ: 1 Stück

Modell Nr.:HDL-DMS-200
Kundenspezifische:Kundenspezifische
Portabel:Portabel
Bescheinigung:CE
Gas:CO2
Art:Laser Gas Analyzer

Wuhan HAE Technology Co., Ltd.

[Provinz: Hubei, China]

Anbieter Lieferant

Beweglicher Staub-Konzentrations-Messinstrument-Partikel-Zählwerk-Sensor

Einheitspreis: US $ 2000.0-10000.0 / Stück
MOQ: 1 Stück

Modell Nr.:HDL-PC-3A
Kundenspezifische:Kundenspezifische
Portabel:Portabel
Bescheinigung:CESGS
Gas:CO2
Art:Laser Gas Analyzer

Wuhan HAE Technology Co., Ltd.

[Provinz: Hubei, China]

Anbieter Lieferant

Beweglicher Laser-Staub-Konzentrations-Detektor

Einheitspreis: US $ 2000.0-5000.0 / Stück
MOQ: 1 Stück

Modell Nr.:HDL-DMS-200
Kundenspezifische:Kundenspezifische
Portabel:Portabel
Bescheinigung:CESGS
Gas:CO2
Art:Elektrochemische Gas Analyzer

Wuhan HAE Technology Co., Ltd.

[Provinz: Hubei, China]

Anbieter Lieferant

Automatische Nahrungsmittelbeutel-Verpackungs-Verpackmaschine für Puder u. flüssige Plombe

Einheitspreis: US $ 23980.0-24687.0 / Stück
MOQ: 1 Stück

Modell Nr.:JRS-180Z
Automatischer Grad:Automatisch
Anwendung:Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Und Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Changzhou Jerry Packaging Technology

[Provinz: Jiangsu, China]

Anbieter Lieferant

Zuckerstock-Beutel-Verpackmaschine

Einheitspreis: US $ 1.0-3300.0 / Set
MOQ: 1 Set

Modell Nr.:AP-110BG
Automatischer Grad:Automatisch
Anwendung:Milchprodukte,Tee,SnackReismehl
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Guangzhou Autopaking Machinery Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Soße-Quetschkissen-Paket-verpackenverpackungsmaschine mit dem Füllen u. dem Dichten

Einheitspreis: US $ 17720.0-17990.0 / Stück
MOQ: 1 Stück

Modell Nr.:JLV-110
Automatischer Grad:Automatisch
Anwendung:Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Changzhou Jerry Packaging Technology

[Provinz: Jiangsu, China]

Anbieter Lieferant

Körnchen /Salt, das &Packing Maschine füllt

Einheitspreis: US $ 1.0-99999.0 / Set
MOQ: 1 Set

Modell Nr.:AP-200BV
Automatischer Grad:Automatisch
Anwendung:Milchprodukte,Tee,SnackReismehl
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Guangzhou Autopaking Machinery Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

18 Kopf-Wäger Combitnation mit Hochgeschwindigkeitsverpackmaschine

Einheitspreis: US $ 1.0-99999.0 / Set
MOQ: 1 Set

Modell Nr.:AP-42120BG
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Milchprodukte,Tee,SnackReismehl
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:BildungFüllung

Guangzhou Autopaking Machinery Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Automatische Füllmaschine-Dichtungs-Maschinen-Ersatzteil

Einheitspreis: US $ 1.0-99999.0 / Set
MOQ: 1 Set

Automatischer Grad:Automatisch
Anwendung:SnackReismehl
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung
Driven Type:Pneumatisch

Guangzhou Autopaking Machinery Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Automatische Medizin oder Kosmetik-Flaschen-kartonierenmaschine

Einheitspreis: US $ 31050.0-32820.0 / Stück
MOQ: 1 Stück

Modell Nr.:JCZK-125KH 
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Box Molding
Bildungsfunktion:Bildung,FüllungDichtung

Changzhou Jerry Packaging Technology

[Provinz: Jiangsu, China]

Anbieter Lieferant

Automatische Blase oder Einspritzung-kartonierenmaschine

Einheitspreis: US $ 31050.0-32820.0 / Stück
MOQ: 1 Stück

Modell Nr.:JCZK-125KH 
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Box Molding
Bildungsfunktion:Bildung,FüllungDichtung

Changzhou Jerry Packaging Technology

[Provinz: Jiangsu, China]

Anbieter Lieferant

Automatische bildenfüllende Dichtungs-Gewürze u. Masala Puder-Verpackungs-Verpackmaschine

Einheitspreis: US $ 20880.0-21318.0 / Stück
MOQ: 1 Stück

Modell Nr.:JLV-140
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Changzhou Jerry Packaging Technology

[Provinz: Jiangsu, China]

Anbieter Lieferant

Automatische Nahrung, kosmetisches reinigendes flüssiges Beutel-Paket-verpackenverpackungsmaschine

Einheitspreis: US $ 28980.0-29687.0 / Stück
MOQ: 1 Stück

Modell Nr.:JRS-210Z
Automatischer Grad:Automatisch
Anwendung:Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Und Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Changzhou Jerry Packaging Technology

[Provinz: Jiangsu, China]

Anbieter Lieferant

5000+Pixel Vsee Farben-Sorter-philippinische Getreidemühle

Einheitspreis: US $ 30000 / Stück
MOQ: 1 Stück

Modell Nr.:CA-3
Art:Rice Mill
Anwendung:Alle
Spannung:220V
Aussehen:Vertikal
Pressematerial:Reis

NahrungsmittelstadiumPulverizer mit Staub-Sammler

Einheitspreis: US $ 11800 / Stück
MOQ: 1 Stück

Modell Nr.:CWF15
Art:Flour Mill
Anwendung:Alle
Aussehen:Horizontal
Zustand:Neu
Kundenspezifische:Kundenspezifische

Jun Lang Machinery Co., Ltd.

[Provinz: Jiangsu, China]

Anbieter Lieferant

Multifunktionsgetreide-Reis-Bohnen-Leistung-Schleifmaschine

Einheitspreis: US $ 900.0-1000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:Hk-860
Art:Flour Mill
Anwendung:Bohnen
Spannung:220V
Aussehen:Horizontal
Zustand:Neu

Getreidemühle bearbeitet 50t pro Tag China Qualitätsmais-Getreidemühle-Maschinen maschinell

Einheitspreis: US $ 65000.0-125000.0 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CIF

Modell Nr.:50t/24h
Art:Flour Mill
Anwendung:Mehl,Alle,Bohnen,Weizen,StärkeReismehl
Aussehen:Vertikal
Press Series:Zweite
Zustand:Neu

China-trockene Nahrung- für Haustiereaufbereitende Zeile

Einheitspreis: US $ 70000 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:DSE85-P
Anwendung:Hund,Fisch,KatzeVogel
Warenzeichen:Dingrun
Verpackung:Wood Packing
Standard:food degree stainless steel material
Herkunft:Jinan China

Jinan Dingrun Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

Kern-füllende Imbiss-Nahrung, die Maschine (DSE70-III, herstellt)

Einheitspreis: US $ 10000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, EXW, CIF

Modell Nr.:DSE70-III
Anwendung:Süßigkeiten,Schokolade,Popcorn,Pommes fritesKeks
Warenzeichen:Dingrun
Verpackung:Wooden Cases
Standard:CE
Herkunft:Jinan, Shandong

Jinan Dingrun Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

Künstliche Reis-Maschine (DSE70)

Einheitspreis: US $ 10000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:DSE70
Warenzeichen:Dingrun
Verpackung:Wooden Cases
Standard:CE
Herkunft:Jinan, Shandong
HS-Code:8438800000

Jinan Dingrun Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

Strukturierte Sojabohnenöl-Protein-Maschine (SLG)

Einheitspreis: US $ 20000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, EXW, CIF

Modell Nr.:SLG85
Warenzeichen:Dingrun
Verpackung:Wooden Cases
Standard:CE
Herkunft:Jinan, Shandong
HS-Code:84388000

Jinan Dingrun Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

Strukturierte Sojabohnenöl-Protein-Fleisch-Maschinen-Nahrungsmittelmaschinerie (SLG)

Einheitspreis: US $ 20000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, EXW, CIF

Modell Nr.:SLG85
Warenzeichen:Dingrun
Verpackung:Wooden Cases
Standard:CE
Herkunft:Jinan, Shandong
HS-Code:84388000

Jinan Dingrun Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

Automatisches Rotary Packig Machine für Food

Einheitspreis: US $ 18000.0-20000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB

Modell Nr.:GD6-200
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Milchprodukte,SnackReismehl
Art:Und Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:FüllungDichtung

Wenzhou KEDI Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Vollautomatische industrielle luftgestoßene Frühstückskost- aus Getreidemaschine

Einheitspreis: US $ 8600 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF, DAT, FAS, DDP, DAP, CIP, CPT, FCA, EXW

Modell Nr.:KLD- puffed breakfast cereals machine
Warenzeichen:KLD
Verpackung:Wooden Case
Standard:CE, ISO9001
Herkunft:Jinan, Shandong
HS-Code:843880000

Jinan Kelid Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

Hohe automatische industrielle sofortige Nudel-Maschine

Einheitspreis: US $ 22000 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF, DAT, FAS, DDP, DAP, CIP, CPT, FCA, EXW

Modell Nr.:KLD- instant noodles machine
Anwendung:Pommes frites
Kundenspezifische:Kundenspezifische
Warenzeichen:KLD
Verpackung:Wooden Case
Standard:CE, ISO9001

Jinan Kelid Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

Vollautomatische industrielle Säuglingsnahrung-Maschine

Einheitspreis: US $ 8500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DAT, FAS, DDP, DAP, CIP, CPT, FCA, EXW

Modell Nr.:KLD- Baby Food Machine
Warenzeichen:KLD
Verpackung:Wooden Case
Standard:CE, ISO9001
Herkunft:Jinan, Shandong
HS-Code:84388000

Jinan Kelid Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

Nudel der japanische Art-Nudel-300g Soba

Einheitspreis: US $ 1 / Box
MOQ: 1 Box
Handelsbedingungen: FOB, CFR, EXW

Modell Nr.:300g sobanoodle
Bescheinigung:BRC,ISO,FDAHACCP
Verpackungsmaterial:Kunststoff
Speichermethode:Normal
Haltbarkeit:> 12 Monate
Art:Fast Food

Beijing Shipuller Co., Ltd.

[Provinz: Beijing, China]

Anbieter Lieferant

Automatische Nudel, Isolationsschlauch, Teigwaren-vertikale Verpackungsmaschine

Einheitspreis: US $ 10000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:LS-08
Verpackungsart:Tasche
Art:Automatische Verpackungsmaschine
Driven Type:Elektrisch
Anwendung:Milchprodukte,SnackReismehl
Automatischer Grad:Automatisch

Halb automatische Puder-Füllmaschine

Einheitspreis: US $ 1.0-10000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, EXW, CIF, CIP

Modell Nr.:DF2000
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Tee,Gemüse Obst,SnackReismehl
Art:Und Verschließmaschine
Enden Spezies:Flaschenformungs
Bildungsfunktion:Füllung
Brauchen Sie Hilfe?
Kontaktieren Sie bitte uns.
Verwandte Schnellsuche Kategorien
Durchsuchen Sie unsere SGS geprüfte Datenbank von Agrar-Zulieferern und setzen Sie sich mit den besten Lebensmittel-Profis in Verbindung, die jede Ihre Nachfrage decken können. Finden Sie heraus, welche Auswirkung ein Qualitätsanbieter von Obst & Gemüse auf Ihre zukünftige Geschäftsentwicklung haben kann. Wir dienen als umfassende Quelle von Agrar- & Lebensmittelherstellern quer durch China, und hier ist die Liste der Bezugsquellen / Hersteller, die mit Ihrer Produktsuche nach Mehl Lebensmittel fabrik übereinstimmen. Importeure wie Sie können großartige Angebote zu Fabrikpreisen für maschinen für die nahrungs, lebensmittel- maschine, nahrungsmittelmaschinen erhalten. Gemüsegroßhändler, Obstlieferanten, Exporteure von Milchprodukten, Nahrungsmittelhersteller, ungeachtet welche Lebensmittelexporteure in China Sie benötigen, hier werden Sie fündig. Nehmen Sie direkten Kontakt auf & erhalten Sie Preisangebote in Echtzeit!
Schnellproduktverzeichnis