Startseite » Landwirtschaft & Essen » Extrakt Aus Tier und Pflanze » Mehl Lebensmittel
Schnellproduktverzeichnis Schnelllieferantenverzeichnis
Seite 19/1456  
Insgesamt 43674 Produkte von etwa 3119

Mehl Lebensmittel

Hersteller & Lieferanten
China-Lieferant - Gold-Mitglied
Sortieren nach: Relevanz
Zeigen: 30 artikel

Seife Autofeeding Kissen-Verpackungsmaschine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 10000.0-20000.0 / Stück
MOQ: 1 Stück

Verpackungsart:Tasche
Art:Automatische Verpackungsmaschine
Driven Type:Elektrisch
Anwendung:Getränke,Reinigung, Reinigungsmittel,Skin Care Produkte,Kosmetika,Öl,Hair Care Produkte,Milchprodukte,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Automatischer Grad:Automatisch
Inclusion Degree:Vollumwickelte Wickelmaschine

Qingdao Fourstar Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

China-Qualitätsmehl-Vibrierensieb-Hersteller

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 1000.0-2000.0 / Stück
MOQ: 1 Stück

Modell Nr.:DZ
Art:Kreisförmig
Funktion:Hochfrequenzvibrations Bildschirm
Übertragungsstruktur:Rüttelsieb
Verwendung:Leichte Fein Shaker
Werk:Drehschieber Shaker

Puder Vier-Seite Dichtung u. Mehrkanalverpackungsmaschine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 55000 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:DXDO-F900E
In der Industrie anzuwendende:Essen,Ware,ChemikalieMedizinische
Warenzeichen:zhongbao
Verpackung:Wooden Case
Standard:CE, ISO9001
Herkunft:Wenzhou Ruian

Hirse-Nudeln

Ausgewählte Produkt des China-Lieferant

MOQ: 20 Tonnen

Modell Nr.:L-8
Verpackungsmaterial:Papier
Speichermethode:Normal
Haltbarkeit:6 Monate-12 Monate
Verarbeitungsart:Roh
Art:Weizen

ZIBO LVSHUANG FOOD CO., LTD.

[Provinz: Shandong, China]

Anbieter Lieferant

Multifunktionsbiskuit-Produktionszweig (BCQ225-1000)

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 100000.0-150000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB

Modell Nr.:BCQ225-1000
Anwendung:Keks
Warenzeichen:SHINWEI
Verpackung:Wooden Case
Standard:CE
Herkunft:Shanghai China

Natürliche trockene Hundenahrung

Art:Pet Pflegen & Health Products
Spezies:Hund
Anwendung:Adult PetPuppy Pet
Aussehen:Trocken
Feature:All Natural
Spec:0-99g

Hebei Shouen Trade Co., Ltd

[Provinz: Hebei, China]

Kundenspezifisches Drucken-Fastfood- Verpacken- der Lebensmittelplastikbeutel mit Reißverschluss

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 0.05-0.8 / Stück
MOQ: 10000 Stück

Modell Nr.:ZB-011
Anwendung:LebensmittelFörderung
Feature:Moisture Proof,RecycelbarBiologisch abbaubar
Material:BOPP
Form:Seal Bag
Prozess:Plastic Packaging Taschen

Qingdao Zhongbang Packaging Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied

Nylontee-Filter

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 0.95 / Roll
MOQ: 1 Roll

Modell Nr.:MAISHI-OKL
Material:Nylon
Gewebeart:Ebene
Elastizität:Hoch
Warenzeichen:MS
Verpackung:PVC Bag and Carton

Brot-Kuchen-Verpacken-Maschinerie

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 10000.0-20000.0 / Stück
MOQ: 1 Stück

Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung
Driven Type:Elektrisch

Qingdao Fourstar Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

Qualitäts-Beschaffenheits-Sojabohnenöl-Protein-aufbereitende Zeile

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 26000 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, EXW, CIF

Modell Nr.:DSE85
Art:Drücken Machines
Anwendung:Mehl,Alle,Bohnen,Weizen,StärkeReismehl
Spannung:380V
Aussehen:Vertikal
Pressematerial:Sojabohne

Jinan Dingrun Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

Automatische Nahrung- für HaustiereVerpackungsmaschine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 20000.0-30000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:DXD-520C
Automatischer Grad:Automatisch
Anwendung:SnackReismehl
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Dichtung

Ruian Haicheng Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Intelligente vertikale Hochgeschwindigkeitsverpackmaschine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 7600.0-8300.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, CIP, CPT, FCA, EXW

Modell Nr.:CP420B-II
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Dichtung

Doppelschneckenpresse zur Herstellung von Fischmehl

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 38000 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF, CPT, EXW

Modell Nr.:P-XH-300
Kundenspezifische:Kundenspezifische
Bescheinigung:CE
Automatischer Grad:Semi-Automatic
Warenzeichen:XINHONG
Verpackung:Bulk in Container

Verdrängte trockene Haustier-Hundefisch-Zufuhr-Nahrungsmittelprozeßzeile

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 10000.0-25000.0 / Set
MOQ: 1 Set

Modell Nr.:KS-65
Energiequelle:Elektro
Automatischer Grad:Automatische
Anwendung:Hund
Einzugstyp:Sojamehl
Kundenspezifische:Kundenspezifische

Jinan Keysong Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

Punkt-Zubehör-Heizungs-Mischer 200 Kilogramm Belüftung-Puder

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 5000.0-15000.0 / Stück
MOQ: 1 Stück

Modell Nr.:200kg pvc mixer
Mischer Typ:Agitator
Arbeits:Konvektion Mixer
Rühren Type:Tauchen
Anwendung:Flüssigkeit mit Feststoff,Pulver,Viskose Flüssigkeit,FlüssigkeitGranulat
Bescheinigung:CEISO

Hohes Absorptions-Eisen gründete Sauerstoff-Sauger für Nahrungsmittelspeicher und -schutz

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 43.5-48.0 / Box
MOQ: 5 Boxen

Modell Nr.:DX-CC
Form:Beads
Trockenmittel:Physikalische Trockenmittel
Warenzeichen:DX
Verpackung:Composite Membrane
Herkunft:China, Dongguan

Dongguan Dingxing Industry Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Sich hin- und herbewegender Fisch-Zufuhr-Extruder, Fisch-Zufuhr-Maschinerie

Ausgewählte Produkt des China-Lieferant

MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:SLG85
Anwendung:Fisch
Einzugstyp:Fischmehl
Kundenspezifische:Kundenspezifische
Warenzeichen:Jinan Datong Machinery Company
Verpackung:Woodcase

Jinan Datong Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

Fischkochmaschine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 20000.0-30000.0 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF, CPT, EXW

Warenzeichen:XINHONG
Verpackung:Bulk in Container
Standard:BV, SGS, ISO certified
Herkunft:China
HS-Code:8419899090
Produktionskapazität:60 Set/Year

Containerisiertes konkretes abkühlendes Eis-Pflanzensystem

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 69938.0-82381.0 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:LR-30T
Eisherstellung:Fließend
Kühl Way:Wassergekühlte
Automatisierung:Automatisierung
Maschinen-Größe:Groß
Ice-Form:Flake Ice

Europäischer Standard-Weizen-Getreidemühle

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 5000 / Ton
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:50 - 2400 TONS / 24h
Art:Flour Mill
Anwendung:Mehl
Spannung:380V
Zustand:Neu
Kundenspezifische:Kundenspezifische

Hebei Africa Machinery Co., Ltd.

[Provinz: Hebei, China]

Anbieter Lieferant

Film Bag Wrapping Full Stainless Automatic Flow Packing Machine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 3800.0-8000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CIF

Modell Nr.:ALD-250-320-350-450-600
Automatischer Grad:Automatisch
Anwendung:Kosmetika,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Und Verschließmaschine
Enden Spezies:Schmelzformen
Bildungsfunktion:Bildung,FüllungDichtung

Bewegliche PA lamellierte Körner/Mehl/Reis-Kunststoffgehäuse-Beutel

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 0.08-0.09 / Stück
MOQ: 15000 Stück

Modell Nr.:RB-02
Anwendung:Lebensmittel,Förderung,Haushalt,ChemikalieKleider
Feature:Moisture Proof,Recycelbar,Biologisch abbaubar,Shock ResistanceAntistatisch
Material:Schichtwerkstoff
Form:Plastiktaschen
Prozess:Plastic Packaging Taschen

Doppelte Torsion-Süßigkeit-Verpackmaschine (FND-S800)

Ausgewählte Produkt des China-Lieferant

MOQ: 1 SET
Handelsbedingungen: FOB, CFR, EXW, CIF, CIP

Modell Nr.:FND-S800
Verpackungsart:Cartons
Art:Automatische Verpackungsmaschine
Driven Type:Elektrisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Hair Care Produkte,Milchprodukte,Tee,SnackReismehl
Automatischer Grad:Automatisch

Taizhou Funengda Industry Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Metalldetektor, Metalldetektoren, Covneyor Metalldetektor, Riemen-Metalldetektor, Jl-M3010 für ...

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 100 / PC
MOQ: 1 PC
Handelsbedingungen: FOB

Modell Nr.:JL-M3010
Zertifizierung:CE
Alarm-Formular:Ton und Licht Alarm
Verpackung:Wooden Case
Standard:CE
Herkunft:Shanghai, China

Jinlong Industrial Company Limited

[Provinz: Shanghai, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied

SelbstInjera, das Maschine/Injera Maschine/Krepp-Maschinerie/Produktionszweig Äthiopien-Injera ...

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 2000.0-50000.0 / set
MOQ: 1 set

Modell Nr.:6QP-3620
Anwendung:Mehl,Alle,Bohnen,Weizen,StärkeReismehl
Zustand:Neu
Kundenspezifische:Kundenspezifische
Warenzeichen:SHENGXING
Verpackung:Export Plywood Box

5-500t Flour Mill für Wheat, Flour Mill für Rice, Flour Mill für Corn, Flour Mill für Maize

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 20000.0-100000.0 / Set
MOQ: 1 Set
Handelsbedingungen: CFR, CIF

Modell Nr.:6FTF
Anwendung:MehlWeizen
Art:Flour Mill
Aussehen:Vertikal
Press Series:Zweite
Warenzeichen:LONG TING

luftgestoßene Imbißnahrung mit füllendem Produktionszweig der Erdnussbutter

MOQ: 8000 Stück

Modell Nr.:Amy 0086 15020006735 DSE65, 70, 85
Bescheinigung:CEISO 9001
Energiequelle:Elektro
Automatischer Grad:Automatische
Kundenspezifische:Kundenspezifische
Warenzeichen:DINGRUN

Jinan Dingrun Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

1.0-2.0t/H Dry Type Cat and Dog Feed Extruder Fish Food Pellet Machine

Ausgewählte Produkt des China-Lieferant

MOQ: 1 set
Handelsbedingungen: FOB, CFR, CIF, FCA, EXW

Modell Nr.:AZSG
Art:Pellet Mill
Verarbeitung Technics:Crushing-before-Mixing
Siebgewebe:Ohne Siebgewebe
Zerkleinerungsgeräte Typ:Feed-Hammermühle
Pellet Mill Typ:Schraube Granulator

Lebensmittel-Zusatzstoff-wasserfreier Kalziumazetat-Preis für Konservierungsmittel CAS 62-54-4

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 1.2-1.8 / kg
MOQ: 100 kg

Modell Nr.:Calcium Acetate
Art:Meat Konservierungsmittel
Wirkung:Antiseptisch
Ressource:Organische chemische Konservierungsstoffe
Warenzeichen:Calcium Acetate
Verpackung:25kg Bag

A.M FOOD CHEMICAL CO., LIMITED

[Provinz: Shandong, China]

Anbieter Lieferant

Kleine Mais-Mais-Mehl-Fräsmaschine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 10000.0-120000.0 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF

Anwendung:MehlAlle
Art:Rice Mill
Aussehen:Vertikal
Press Series:Zweite
Warenzeichen:LONG TING
Verpackung:Wooden Packing
1-10 11-20 21-30 31-40 41-50 51-60 ...
Brauchen Sie Hilfe?
Kontaktieren Sie bitte uns.
Verwandte Schnellsuche Kategorien
Durchsuchen Sie unsere SGS geprüfte Datenbank von Agrar-Zulieferern und setzen Sie sich mit den besten Lebensmittel-Profis in Verbindung, die jede Ihre Nachfrage decken können. Finden Sie heraus, welche Auswirkung ein Qualitätsanbieter von Obst & Gemüse auf Ihre zukünftige Geschäftsentwicklung haben kann. Wir dienen als umfassende Quelle von Agrar- & Lebensmittelherstellern quer durch China, und hier ist die Liste der Bezugsquellen / Hersteller, die mit Ihrer Produktsuche nach Mehl Lebensmittel fabrik übereinstimmen. Importeure wie Sie können großartige Angebote zu Fabrikpreisen für maschinen für die nahrungs, lebensmittel- maschine, nahrungsmittelmaschinen erhalten. Gemüsegroßhändler, Obstlieferanten, Exporteure von Milchprodukten, Nahrungsmittelhersteller, ungeachtet welche Lebensmittelexporteure in China Sie benötigen, hier werden Sie fündig. Nehmen Sie direkten Kontakt auf & erhalten Sie Preisangebote in Echtzeit!
Schnellproduktverzeichnis