Startseite » Landwirtschaft & Essen » Extrakt Aus Tier und Pflanze » Mehl Lebensmittel
Schnellproduktverzeichnis Schnelllieferantenverzeichnis
Seite 21/1534  
Insgesamt 46010 Produkte von etwa 4182

Mehl Lebensmittel

Hersteller & Lieferanten
China-Lieferant - Gold-Mitglied
Sortieren nach: Relevanz
Zeigen: 30 artikel

Verdrängte trockene Haustier-Hundefisch-Zufuhr-Nahrungsmittelprozeßzeile

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 10000.0-25000.0 / Set
MOQ: 1 Set

Modell Nr.:KS-65
Energiequelle:Elektro
Automatischer Grad:Automatische
Anwendung:Hund
Einzugstyp:Sojamehl
Kundenspezifische:Kundenspezifische

Jinan Keysong Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

Kleine Maschine des Biskuit-Kh-250 für Nahrungsmittelfabrik

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 4000.0-100000.0 / Set
MOQ: 1 Set

Modell Nr.:KH-250
Bescheinigung:CEISO 9001
Energiequelle:Elektro
Automatischer Grad:Automatische
Anwendung:Keks
Kundenspezifische:Kundenspezifische

Vertikale Formular-Fülle-Dichtungs-Verpackmaschine (PM-720)

Ausgewählte Produkt des China-Lieferant

MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:PM-720
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung

Alpha-Pack (Heyuan) Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Hohes Absorptions-Eisen gründete Sauerstoff-Sauger für Nahrungsmittelspeicher und -schutz

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 43.5-48.0 / Box
MOQ: 5 Boxen

Modell Nr.:DX-CC
Form:Beads
Trockenmittel:Physikalische Trockenmittel
Warenzeichen:DX
Verpackung:Composite Membrane
Herkunft:China, Dongguan

Dongguan Dingxing Industry Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Brot-Produktionszweig/Brot-Backen-Zeile beenden, um das Laib Brot toasten zu lassen

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 10000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF

Verwendung:Keks,Kuchen,PizzaBrot
Energiequelle:Elektro
Zeitmessgerät:Ohne Zeitmessgerät
Spannung:380V
Kundenspezifische:Kundenspezifische
Warenzeichen:OMEGA

Autoteil-flüssige Verbinder-Kühler-Rohr-Zeile

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 2 / Stück
MOQ: 1000 Stück
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:Auto parts fluid connector radiator pipe line
Material:Stahl
Deck:Single
Warenzeichen:LITUO
Verpackung:Plastic Bag+Carton
Standard:CE

Yuyao Lituo Auto Parts Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Hirse-Nudeln

Ausgewählte Produkt des China-Lieferant

MOQ: 20 Tonnen

Modell Nr.:L-8
Verpackungsmaterial:Papier
Speichermethode:Normal
Haltbarkeit:6 Monate-12 Monate
Verarbeitungsart:Roh
Art:Weizen

ZIBO LVSHUANG FOOD CO., LTD.

[Provinz: Shandong, China]

Anbieter Lieferant

Vertikale Puder-Verpackungsmaschine (klein)

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 3500.0-4500.0 / Set
MOQ: 1 Set

Modell Nr.:HTL-400F
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Skin Care Produkte,Milchprodukte,Hair Care Produkte,TeeGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Ruian Honetop Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Qualitätsvibrierendes Sieb für Art der Puder und des flüssigen Materials

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 1000.0-2000.0 / Stück
MOQ: 1 Stück

Modell Nr.:DZ
Art:Kreisförmig
Funktion:Hochfrequenzvibrations Bildschirm
Übertragungsstruktur:Rüttelsieb
Verwendung:Leichte Fein Shaker
Werk:Drehschieber Shaker

3 ServoFull-Automatic leistungsfähige Verpacken- der Lebensmittelmaschinen-genehmigte automatisches ...

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 6950 / Stück
MOQ: 1 Stück

Modell Nr.:XDB-500
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Wenzhou Kotek Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Konkurrenzfähiger Preis-Qualitäts-verschiedener Typ Carboxy Methyl Zellulose (CMC)

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 700.0-1000.0 / Ton
MOQ: 1 Ton
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:Caboxy Methyl Cellulose
Carboxyl No.:Dicarbonsäure
Alkyl No.:Fettsäure
Aussehen:Pulver
Quelle:Hydrolyse
Farbe:Weiß

Dalian Chem Imp.& Exp. Group Co., Ltd.

[Provinz: Liaoning, China]

Anbieter Lieferant

Qualitäts-Beschaffenheits-Sojabohnenöl-Protein-aufbereitende Zeile

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 26000 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, EXW, CIF

Modell Nr.:DSE85
Art:Drücken Machines
Anwendung:Mehl,Alle,Bohnen,Weizen,StärkeReismehl
Spannung:380V
Aussehen:Vertikal
Pressematerial:Sojabohne

Jinan Dingrun Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

Mais-Rotationen/Kurkure/Cheetos/Corn knirscht Nahrungsmittelextruder-Maschine und aufbereitende ...

Ausgewählte Produkt des China-Lieferant

MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:SMT
Verarbeitung Material:Tierische Rohstoffe,Forest Products,Sonderprodukte Landwirtschaft,Garden Products,Agronomische ProdukteNatürliche Zutaten
Anwendung:Tierfutter,SchokoladeGetränk
Kundenspezifische:Kundenspezifische
Bescheinigung:CE,GETROFFEN,CSA,UL,SA8000ISO 9001
Energiequelle:Elektro

Multifunktionsbiskuit-Produktionszweig (BCQ225-1000)

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 100000.0-150000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB

Modell Nr.:BCQ225-1000
Anwendung:Keks
Warenzeichen:SHINWEI
Verpackung:Wooden Case
Standard:CE
Herkunft:Shanghai China

Automatische Nahrung- für HaustiereVerpackungsmaschine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 20000.0-30000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:DXD-520C
Automatischer Grad:Automatisch
Anwendung:SnackReismehl
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Dichtung

Ruian Haicheng Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Heiße Verkaufs-Paddy-Startwert- für ZufallsgeneratorReismühle-aufbereitende Maschine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 36000 / Stück
MOQ: 1 Stück

Modell Nr.:RC-006
Art:Rice Mill
Anwendung:Alle
Spannung:220V
Aussehen:Einachsigen
Zustand:Neu

Seife Autofeeding Kissen-Verpackungsmaschine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 10000.0-20000.0 / Stück
MOQ: 1 Stück

Verpackungsart:Tasche
Art:Automatische Verpackungsmaschine
Driven Type:Elektrisch
Anwendung:Getränke,Reinigung, Reinigungsmittel,Skin Care Produkte,Kosmetika,Öl,Hair Care Produkte,Milchprodukte,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Automatischer Grad:Automatisch
Inclusion Degree:Vollumwickelte Wickelmaschine

Qingdao Fourstar Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

China-Qualitätsmehl-Vibrierensieb-Hersteller

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 1000.0-2000.0 / Stück
MOQ: 1 Stück

Modell Nr.:DZ
Art:Kreisförmig
Funktion:Hochfrequenzvibrations Bildschirm
Übertragungsstruktur:Rüttelsieb
Verwendung:Leichte Fein Shaker
Werk:Drehschieber Shaker

Puder Vier-Seite Dichtung u. Mehrkanalverpackungsmaschine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 55000 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:DXDO-F900E
In der Industrie anzuwendende:Essen,Ware,ChemikalieMedizinische
Warenzeichen:zhongbao
Verpackung:Wooden Case
Standard:CE, ISO9001
Herkunft:Wenzhou Ruian

Halbautomatischer Zucker-/trocknendes Körnchen-füllende Verpackmaschine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 5000 / Stück
MOQ: 1 Stück

Modell Nr.:SGG50
Automatischer Grad:Automatisch
Anwendung:Kosmetika,Getränke,Reinigung, Reinigungsmittel,Skin Care Produkte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,Reismehl,GewürzMilchprodukte
Driven Type:Elektrisch
Verpackungsmaterial:Kunststoff
Warenzeichen:sanypak

Shenzhen Sany Pack Equipment Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Intelligente vertikale Hochgeschwindigkeitsverpackmaschine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 7600.0-8300.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, CIP, CPT, FCA, EXW

Modell Nr.:CP420B-II
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Dichtung

Handelsgebrauch-Gewürz-Schleifer

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 2000.0-8000.0 / Set
MOQ: 1 Set

Modell Nr.:BG-180
Anwendung:Mehl,Alle,Bohnen,Weizen,StärkeReismehl
Aussehen:Vertikal
Press Series:Weiter
Zustand:Neu
Kundenspezifische:Kundenspezifische

Sich hin- und herbewegender Fisch-Zufuhr-Extruder, Fisch-Zufuhr-Maschinerie

Ausgewählte Produkt des China-Lieferant

MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:SLG85
Anwendung:Fisch
Einzugstyp:Fischmehl
Kundenspezifische:Kundenspezifische
Warenzeichen:Jinan Datong Machinery Company
Verpackung:Woodcase

Jinan Datong Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

automatische frische Nudel 5-Stages, die Maschine (SK-5430, herstellt)

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 50000.0-200000.0 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CIF

Modell Nr.:SK-5430
Anwendung:Mehl,WeizenStärke
Zustand:Neu
Kundenspezifische:Kundenspezifische
Warenzeichen:SK-5430
Verpackung:Whole Container or Wooden Case

Solatek Precision Machinery Co., Ltd.

[Provinz: Sichuan, China]

Anbieter Lieferant

Film-Dichtungs-Maschinen-Pedal-Abdichtmassen-Plastik und lamellierendes Beutel-manuelles doppeltes ...

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 90 / Stück
MOQ: 1 Stück

Modell Nr.:KS-F
Verpackung:Tasche
Automatischer Grad:Semi-Automatic
Verpackungsmaterial:Film
Anwendung:Kosmetika,Milchprodukte,Tee,SnackReismehl
Verwendung:Outpacking

Europäischer Standard-Weizen-Getreidemühle

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 5000 / Ton
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:50 - 2400 TONS / 24h
Art:Flour Mill
Anwendung:Mehl
Spannung:380V
Zustand:Neu
Kundenspezifische:Kundenspezifische

Hebei Africa Machinery Co., Ltd.

[Provinz: Hebei, China]

Anbieter Lieferant

Film Bag Wrapping Full Stainless Automatic Flow Packing Machine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 3800.0-8000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CIF

Modell Nr.:ALD-250-320-350-450-600
Automatischer Grad:Automatisch
Anwendung:Kosmetika,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Und Verschließmaschine
Enden Spezies:Schmelzformen
Bildungsfunktion:Bildung,FüllungDichtung

5-500t Flour Mill für Wheat, Flour Mill für Rice, Flour Mill für Corn, Flour Mill für Maize

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 20000.0-100000.0 / Set
MOQ: 1 Set
Handelsbedingungen: CFR, CIF

Modell Nr.:6FTF
Anwendung:MehlWeizen
Art:Flour Mill
Aussehen:Vertikal
Press Series:Zweite
Warenzeichen:LONG TING

100% handgemachtes Dreieck GemüseSamosas 15g/piece

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 1500.0-1600.0 / Ton
MOQ: 10 Tonnen

Bescheinigung:BRCHACCP
Lagertemperatur:<-18 ℃
Verarbeitung:IQF
Art:Landwirtschaftliche Produkte
Verpackung:Carton
Herkunft:Hebei

Cangzhou Qingxiang Food Co., Ltd.

[Provinz: Hebei, China]

Anbieter Lieferant

Containerisiertes konkretes abkühlendes Eis-Pflanzensystem

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 69938.0-82381.0 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:LR-30T
Eisherstellung:Fließend
Kühl Way:Wassergekühlte
Automatisierung:Automatisierung
Maschinen-Größe:Groß
Ice-Form:Flake Ice
Brauchen Sie Hilfe?
Kontaktieren Sie bitte uns.
Verwandte Schnellsuche Kategorien
Durchsuchen Sie unsere SGS geprüfte Datenbank von Agrar-Zulieferern und setzen Sie sich mit den besten Lebensmittel-Profis in Verbindung, die jede Ihre Nachfrage decken können. Finden Sie heraus, welche Auswirkung ein Qualitätsanbieter von Obst & Gemüse auf Ihre zukünftige Geschäftsentwicklung haben kann. Wir dienen als umfassende Quelle von Agrar- & Lebensmittelherstellern quer durch China, und hier ist die Liste der Bezugsquellen / Hersteller, die mit Ihrer Produktsuche nach Mehl Lebensmittel fabrik übereinstimmen. Importeure wie Sie können großartige Angebote zu Fabrikpreisen für maschinen für die nahrungs, lebensmittel- maschine, nahrungsmittelmaschinen erhalten. Gemüsegroßhändler, Obstlieferanten, Exporteure von Milchprodukten, Nahrungsmittelhersteller, ungeachtet welche Lebensmittelexporteure in China Sie benötigen, hier werden Sie fündig. Nehmen Sie direkten Kontakt auf & erhalten Sie Preisangebote in Echtzeit!
Schnellproduktverzeichnis