Startseite » Verpackung und Druck » Verpackungskiste » Obst- Zelle
Schnellproduktverzeichnis Schnelllieferantenverzeichnis
Seite 3/304  
Insgesamt 9107 Produkte von etwa 700

Obst- Zelle

Hersteller & Lieferanten
China-Lieferant - Gold-Mitglied Lizenz Verifizierte Lieferant
Sortieren nach: Relevanz
Zeigen: 30 artikel

Plant Growth Promoter Brassinolide

Ausgewählte Produkt des China-Lieferant

MOQ: 25 kg
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:Brassins
Art:Wachstumsförderer
Verwendung:Pflanzenwachstum fördern
Klassifikation:Brassinosteroid
Form:Pulver

Chengdu Newsun Crop Science Co., Ltd.

[Provinz: Sichuan, China]

Anbieter Lieferant

SuperHard Herbal Sex Product für Man 3800mg Gbsp139

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 1.3-2.0 / box
MOQ: 60 boxes
Handelsbedingungen: FOB, CFR, EXW, CIF

Modell Nr.:GBSP139
Art:Sex Enhancer
Träger:männlich
Form:Solide
Warenzeichen:GOBE
Verpackung:Carton

Guangzhou Gobe Trading Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Chitosan-Derivate

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 20.0-300.0 / kg
MOQ: 100 kg
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:Snow Crab or Shrimp shell
Wirksamkeit:Promote Healthy & Growth
Klassifikation:Food Additives
Art:Antioxidantien
Aussehen:Pulver
Farbe:Gelb

Qingdao Reach International Inc.

[Provinz: Shandong, China]

Anbieter Lieferant

Edelstahl-mischender Sammelbehälter für Nahrung und Kosmetik (ACC-140)

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 1500.0-2000.0 / Stück
MOQ: 1 Stück

Modell Nr.:ACC-140
Verwendung:Verpackung von Waren
Verpackungsmaterial:Metall
Verpackung:Fass
Driven Type:Elektrisch
Art:Verpackung Produktionslinie

Wenzhou Totalpacks Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Lizenz Verifizierte Lieferant

72 Hochdruckmännliche Geschlechts-Vergrößerer-Kräuterpillen, Geschlechts-Pille

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 0.6-1.0 / Stück
MOQ: 1000 Stück

Modell Nr.:sex 006
Altersgruppe:Erwachsene
Geschlecht:Männlich
Verpackung:Box
Lagerung Hinweis:Feuchtigkeit Proof
Produkttyp:Lebensmittel

Guangzhou AFD Trade Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Lizenz Verifizierte Lieferant

Automatisches Zellophan, das Verpackung-Maschine für Duftstoff, Zigarette, Tee, medizinischer, ...

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 16000.0-23000.0 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:FFT
Verpackungsart:Tasche
Art:Automatische Verpackungsmaschine
Driven Type:Elektrisch
Anwendung:Getränke,Reinigung, Reinigungsmittel,Skin Care Produkte,Kosmetika,Hair Care Produkte,Milchprodukte,Tee,Gemüse Obst,Fisch, FleischSnack
Automatischer Grad:Automatisch

Pflanze oder Animal Source 80% Free Amino Acid

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 1500 / Ton
MOQ: 2 Tonnen
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:AA80
Infektion auf Boden:Physiologischen Neutral
Chemical Character:Chemische Neutral
Aussehen:Pulver
Releasetyp:Schnell
Klassifikation:Stickstoff-Dünger

Qingdao Future Group

[Provinz: Shandong, China]

Anbieter Lieferant

Spitzentee Tieguanyin Bienen-Blütenstaub des blütenstaub-100%Natrual, keine Antibiotika, keine ...

Ausgewählte Produkt des China-Lieferant

MOQ: 100 Boxen
Handelsbedingungen: FOB, CFR, CIF, CPT

Modell Nr.:YYFHF-TGYNO: 01
Stil:Rein
Verarbeitungsart:Rein
Verpackung:Bottle/Box
Standard:SGS
Herkunft:China

MiniScale Essential Oil Extractor Equipment mit Highquality

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 7358 / set
MOQ: 1 set
Handelsbedingungen: FOB, CIF

Modell Nr.:yc-020
Kundenspezifische:Kundenspezifische
Material:Rostfreier Stahl
Bescheinigung:CE
Anwendung:Schule,HosipitalLabor
Warenzeichen:Pilotech

Getrocknete Goji Beeren Ningxia-Qualität (WolfBerry)

Ausgewählte Produkt des China-Lieferant

MOQ: 5 Tonnen
Handelsbedingungen: FOB, CIF, EXW

Modell Nr.:Normal Dried Goji Berry
Bescheinigung:ISO,FDAHACCP
Speichermethode:Normal
Haltbarkeit:> 12 Monate
Warenzeichen:zhengqiyuan
Verpackung:100g, 250, 500, 5kg, 10kg, 20kg

Landwirtschaft von Fertilizer Spreader Mounted zu Tractor

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 345.0-365.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:CDR-1000
Anwendung:Weizen,Reis,Mais,Erdnuss,Knollen,Bohnen,BäumeObst
Application Field:LandwirtschaftForstwirtschaft
Funktion:Befruchtung
Pflanzmaschine Typ:Pflanzmaschine
Düngemaschinentyp:Full-Size-Dünger

Ebene-u. Schultaschen-Papiertüten, die Maschine Wfd-400 herstellen

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 45.0-55.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:WFD-400
Verwendung:Brotbeutel
Eigenschaft:Automatische Kleber
Material:Papier
Breite:80-250
Maschinentyp:Schlauchbeutelmaschine

Jiangsu Nanjiang Machinery Co., Ltd.

[Provinz: Jiangsu, China]

Anbieter Lieferant

Edelstahl- Homogenisator mit unterschiedlichen Arbeitsdruck

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 2000.0-10000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:LH-H Series
Anwendung:Milch,JoghurtKäse
Warenzeichen:LIHONG
Verpackung:Wooden Package, Fix in Container, etc
Standard:iso
Herkunft:China

Elektrische Heizungs-industrielle trocknende Gemüsemaschine für Verkauf

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 3500.0-15000.0 / Stück
MOQ: 1 Stück

Modell Nr.:CT-C-III
Struktur:Air Flow Drier
Operative Verfahren:Kontinuierlich
Betriebsdruck:Atmosphärische Dryer
Trocknungsmedium:Luft
Aussehen getrocknete Probe:Masse

Intelligente vertikale Hochgeschwindigkeitsverpackmaschine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 7600.0-8300.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, CIP, CPT, FCA, EXW

Modell Nr.:CP420B-II
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Dichtung

40% Aminosäure-Puder (AminoGrow 40)

Ausgewählte Produkt des China-Lieferant

MOQ: 3 Tonnen
Handelsbedingungen: CFR

Modell Nr.:40% Amino Acid ( SO4 Base )
Zertifizierung:ISO9001
Anwendung:Gemüse,BlumenFrucht
Aussehen:Pulver
Infektion auf Boden:Physiologische Neutral
Chemische Charakterisierung:Chemische Säure

TAGROW CO., LTD.

[Provinz: Beijing, China]

Anbieter Lieferant

Rote Goji Beeren Ningxia-

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 6.23 / kg
MOQ: 500 kg

Modell Nr.:MEDLAR-88001
Lagerung:Schatten
Haltbarkeit:24 Monate
Nährzusammensetzung:Aminosäure,Eiweiß,VitaminMineral
Form:Indehiscent
Trocknungsprozess:AD

Landwirtschaftlicher Luft-Presse-Böe-Obstgarten-Sprüher für Trauben

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 1530.0-1730.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:3MZ - 650
Installation:Außengewinde Anschluss
Flüssigkeit enthalten:MedizinDesinfektor
Spritzform:Flüssigkeitssäule
Volumen:> 500 ml
Energieversorgung:Druck

26 Inch-Screen-Verkaufäutomat

Ausgewählte Produkt des China-Lieferant

MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, EXW, CIF, DDP, DAP

Modell Nr.:LY-511CNR10800
Art:Essen und Trinken
Umweltzustand:Innen-
Charge System:Credit Card
Funktion:Kühlung
Touchscreen:Touch-Screen

Küche-Tuch-Verpackungs-Maschinerie-Wärmeshrink-Papier-Paket-Maschine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 1.0-30000.0 / Stück
MOQ: 1 Stück

Modell Nr.:TPM680/150
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Doppelsiegelmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Shrink-Verpackung/Verpackmaschine

Ausgewählte Produkt des China-Lieferant

MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:SFR
Anwendung:Lebensmittel,Ware,Machinery & Hardware,Textil-,Alkohol und Tabak,Spielzeug,Chemikalie,Kleider,Geschenke & Arts,Speise-Medizinisch
Automatischer Grad:Automatisch
Driven Typ:Elektrisch
Art und Weise der Verpackung:Vierseitendichtungstyp
Stellen Sie Schnell:Frequenzkonversion Speed ​​Regulation

Sea Buckthorn Seed Oil Sea Buckthorn Seed Oil Softgel

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 100 / kg
MOQ: 1 kg
Handelsbedingungen: FOB, CFR, CIF, CIP, CPT

Modell Nr.:pure sea buckthorn seed oil
Rohstoff:Pflanzen
Warenzeichen:KINGHERBS
Verpackung:HDPE Drum for Oil, Carton for Softgel
Standard:SCFE-CO2 pure oil
Herkunft:China

Kingherbs Limited

[Provinz: Hunan, China]

Anbieter Lieferant

Omron Servobewegungsschrumpfverpackung/Verpackungs-Maschine (FFB)

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 10000.0-28000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB

Modell Nr.:FFB
Verpackung:Tasche
Automatischer Grad:Automatisch
Driven Typ:Elektrisch
Art und Weise der Verpackung:Vierseitendichtungstyp
Verpackungsmaterial:Film

Hohe Konzentrations-Bor-Flüssigkeit-Düngemittel

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 2700.0-3100.0 / Ton
MOQ: 1 Ton

Modell Nr.:150g/L Boron fertilizer
Bedingung:Neu
Zertifizierung:ISO9001SGS
Anwendung:Gemüse,BlumenFrucht
Aussehen:Flüssigkeit
Infektion auf Boden:Physiologische Neutral

Qualität von Seaweed Extract Fertilizer (Seaweed Caboron)

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 10000 / liters
MOQ: 3000 liters
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:Seaweed Caboron
Warenzeichen:SEAWINNER
Verpackung:100ml, 250ml, 500ml, 1L, 4L, 5L, 10L
Herkunft:Qingdao, China

Qingdao Seawin Biotech Group Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

Hoher Reinheitsgrad-organisches Düngemittel-Meerespflanze-Auszug-Puder

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 1000.0-2000.0 / Ton
MOQ: 1 Ton
Handelsbedingungen: FOB

Modell Nr.:ALGA WS100
Klassifikation:Organische Dünger
Releasetyp:Schnell
Aussehen:Pulver
Warenzeichen:QFG
Verpackung:as Client' S Requirments

Qingdao Future Group

[Provinz: Shandong, China]

Anbieter Lieferant

Kiefer-Haut-Auszug mit 95% Proanthocyanidins

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 18 / kg
MOQ: 1 kg

Modell Nr.:GS-06
Zertifizierung:RoHS,SGS,BRC,ISO,FDAHACCP
Assay-Verfahren:HPLC-MS,GPC,HPLCUV
Anmeldeformular:Injektion,Lotion,Zäpfchen,Paste,TabletteKapsel
Anwendung:Essen,Health Care ProdukteMedizin
Bundesland:Pulver

Abnehmenkapsel der Gewicht-Verlust-heiße Brandwunde-7

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 2.01-2.99 / Stück
MOQ: 100 Stück

Modell Nr.:AM004BN
Warenzeichen:burn 7
Verpackung:Box
Standard:30 capsules/bottle
Herkunft:Made in China
Produktionskapazität:100000000PCS/Year

Shenzhen City AOM Trade Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Lizenz Verifizierte Lieferant

Fabrik geben Spitzengrad-Weißdorn-Beere narbigen Weißdorn der nahrung2015 an

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 9.5-45.0 / KG
MOQ: 25 KG
Handelsbedingungen: FOB, CIF, EXW

Modell Nr.:ZL0033
Anwendung:Essen
Warenzeichen:Zelang
Verpackung:Double-Layer Bag Inside, Carton Box/Drum Outside
Standard:Food Grade Hawthorn Berry Pitted Hawthorn
Herkunft:China

Epistar Chip hohe Leistung 1000W LED Grow Light Full Spectrum für Greenhouse

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 249 / Stück
MOQ: 2 Stück
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:WYP9100-1000W
Anwendung:Obst und Gemüse,Flowers,Sonderkulturen,Belaubt,ObstSämling
IP-Schutzklassen:IP54
Form:Quadratisch
Garantie:2 Jahre
Leben:50000h

Shenzhen Victory Lighting Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

1-10 11-20 21-30 31-40 41-50 ...
Brauchen Sie Hilfe?
Kontaktieren Sie bitte uns.
Verwandte Schnellsuche Kategorien
Als eine komplette Sourcing-Plattform aus einer Hand für Verpackungs- & Drucktechnik-Lieferanten, sind wir groß genug, um mit der notwendigen Konstruktionskapazität eine erweiterte Produktlinie von Etiketten und Verpackungen anbieten zu können, zugleich aber klein genug, um eine persönliche Betreuung zu bieten, welche auch heute im Geschäftsleben so überaus wichtig ist. Wir bieten Ihnen nicht nur qualitativ hochwertige Etiketten und Verpackungen sondern wertvolle Lösungen. Technologien entwickeln sich fortlaufend weiter, und so auch unsere Lieferanten, die ihre Standards stets auf hohem Niveau halten und in allen Bereichen Innovationen vorantreiben. Angefangen bei ihren Strategien und Endprodukten bis hin zu Fragen hinsichtlich Umwelterhaltung und Umweltschutz. Wir bieten globalen Einkäufern eine vollständige Ressource für ihren Verpackungsbedarf, wie z. B. Obst- Zelle. Darüberhinaus finden Sie weitere Verpackungs- und Drucklösungen, wie z. B. frucht, lebensmittel,, obst, obstverarbeitung zu wettbewerbsfähigen Preisen. Lassen Sie uns Ihnen helfen, unsere wertschöpfenden Produktangebote in Anspruch zu nehmen, um Ihren hohen Heimatmarkt- und Kundenbedürfnissen zu genügen.
Schnellproduktverzeichnis