Startseite » Verpackung und Druck » Verpackungskiste » Obst- Zelle
Schnellproduktverzeichnis Schnelllieferantenverzeichnis
Seite 3/346  
Insgesamt 10379 Produkte von etwa 648

Obst- Zelle

Hersteller & Lieferanten
China-Lieferant - Gold-Mitglied
Sortieren nach: Relevanz
Zeigen: 30 artikel

Neue Auto GPS-Navigation des Ui Android-6.0 für Benz B200 mit Auto-Video

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 180.0-188.0 / Stück
MOQ: 1 Stück

Modell Nr.:XY-BB209
Bildschirmgröße:9-Zoll-
Kombination:GPS,Bluetooth,MP3/MP4 Player,Fernseher,RadioiPod
Platzierung:Armaturenbrett
Bescheinigung:CE,RoHS,FCCISO
Spannung:12/24V

SuperHard Herbal Sex Product für Man 3800mg Gbsp139

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 1.3-2.0 / box
MOQ: 60 boxes
Handelsbedingungen: FOB, CFR, EXW, CIF

Modell Nr.:GBSP139
Art:Sex Enhancer
Träger:männlich
Form:Solide
Warenzeichen:GOBE
Verpackung:Carton

Guangzhou Gobe Trading Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Getrocknete Goji Beeren Ningxia-Qualität (WolfBerry)

Ausgewählte Produkt des China-Lieferant

MOQ: 5 Tonnen
Handelsbedingungen: FOB, CIF, EXW

Modell Nr.:Normal Dried Goji Berry
Bescheinigung:ISO,FDAHACCP
Speichermethode:Normal
Haltbarkeit:> 12 Monate
Warenzeichen:zhengqiyuan
Verpackung:100g, 250, 500, 5kg, 10kg, 20kg

Edelstahl-mischender Sammelbehälter für Nahrung und Kosmetik (ACC-140)

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 1500.0-2000.0 / Stück
MOQ: 1 Stück

Modell Nr.:ACC-140
Warenzeichen:TotalPacks
Verpackung:Tri-Ply Wood
Herkunft:China

Wenzhou Totalpacks Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied

Erdnuss-Kerne

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 1200 / Ton
MOQ: 20 Tonnen
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:24/28
Art:Erdnuss
Verarbeitung:Roh
Warenzeichen:rzjy
Verpackung:Mesh Bag
Standard:Top Quality

Rizhao Jiuyu Export & Import Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

Pflanze oder Animal Source 80% Free Amino Acid

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 1500 / Ton
MOQ: 2 Tonnen
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:AA80
Infektion auf Boden:Physiologischen Neutral
Chemical Character:Chemische Neutral
Aussehen:Pulver
Releasetyp:Schnell
Klassifikation:Stickstoff-Dünger

Qingdao Future Group

[Provinz: Shandong, China]

Anbieter Lieferant

Spitzentee Tieguanyin Bienen-Blütenstaub des blütenstaub-100%Natrual, keine Antibiotika, keine ...

Ausgewählte Produkt des China-Lieferant

MOQ: 100 Boxen
Handelsbedingungen: FOB, CFR, CIF, CPT

Modell Nr.:YYFHF-TGYNO: 01
Stil:Rein
Verarbeitungsart:Rein
Verpackung:Bottle/Box
Standard:SGS
Herkunft:China

Automatisches Zellophan, das Verpackung-Maschine für Duftstoff, Zigarette, Tee, medizinischer, ...

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 16000.0-23000.0 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:FFT
Verpackungsart:Tasche
Art:Automatische Verpackungsmaschine
Driven Type:Elektrisch
Anwendung:Getränke,Reinigung, Reinigungsmittel,Skin Care Produkte,Kosmetika,Hair Care Produkte,Milchprodukte,Tee,Gemüse Obst,Fisch, FleischSnack
Automatischer Grad:Automatisch

Maschine-Düngemittel-Spreizer CDR-1000

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 345.0-365.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:CDR-1000
Anwendung:Weizen,Reis,Mais,Erdnuss,Knollen,Bohnen,BäumeObst
Application Field:LandwirtschaftForstwirtschaft
Funktion:Befruchtung
Pflanzmaschine Typ:Pflanzmaschine
Düngemaschinentyp:Full-Size-Dünger

Superqualitätsautomatische Ei-Tellersegment-Maschine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 8900.0-43000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:HY-3
Trocknungsfunktion:Mit Trocken Funktion
Automatischer Grad:Automatisch
Computersteuerung:Computersteuerung
Größe:Medium
Bescheinigung:CE

GongYi HengYuan Industry Co., Ltd.

[Provinz: Henan, China]

Anbieter Lieferant

MiniScale Essential Oil Extractor Equipment mit Highquality

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 7358 / set
MOQ: 1 set
Handelsbedingungen: FOB, CIF

Modell Nr.:yc-020
Kundenspezifische:Kundenspezifische
Material:Rostfreier Stahl
Bescheinigung:CE
Anwendung:Schule,HosipitalLabor
Warenzeichen:Pilotech

Neues Ui androides Auto GPS des Systems-6.0 für Tiguan 2013 mit Auto-Navigation

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 180.0-188.0 / Stück
MOQ: 1 Stück

Modell Nr.:XY-13VTN10
Kombination:GPS,Bluetooth,MP3/MP4 Player,Fernseher,RadioiPod
Platzierung:Armaturenbrett
Bescheinigung:CE,RoHS,FCCISO
Spannung:12/24V
Unterstützung Format:RMVB

Organische rote Goji Beeren Ningxia-

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 9.8 / kg
MOQ: 500 kg

Modell Nr.:MEDLAR-88001
Geschmack:Süß
Wärme:Warm
Art:Beere
Stil:Ganze
Warenzeichen:Medlar

Elektrische Heizungs-industrielle trocknende Gemüsemaschine für Verkauf

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 3500.0-15000.0 / Stück
MOQ: 1 Stück

Modell Nr.:CT-C-III
Struktur:Air Flow Drier
Operative Verfahren:Kontinuierlich
Betriebsdruck:Atmosphärische Dryer
Trocknungsmedium:Luft
Aussehen getrocknete Probe:Masse

Edelstahl- Homogenisator mit unterschiedlichen Arbeitsdruck

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 2000.0-10000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:LH-H Series
Anwendung:Milch,JoghurtKäse
Warenzeichen:LIHONG
Verpackung:Wooden Package, Fix in Container, etc
Standard:iso
Herkunft:China

Ebene-u. Schultaschen-Papiertüten, die Maschine Wfd-400 herstellen

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 45.0-55.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:WFD-400
Verwendung:Brotbeutel
Eigenschaft:Automatische Kleber
Material:Papier
Breite:80-250
Maschinentyp:Schlauchbeutelmaschine

Jiangsu Nanjiang Machinery Co., Ltd.

[Provinz: Jiangsu, China]

Anbieter Lieferant

40% Aminosäure-Puder (AminoGrow 40)

Ausgewählte Produkt des China-Lieferant

MOQ: 3 Tonnen
Handelsbedingungen: CFR

Modell Nr.:40% Amino Acid ( SO4 Base )
Zertifizierung:ISO9001
Anwendung:Gemüse,BlumenFrucht
Aussehen:Pulver
Infektion auf Boden:Physiologische Neutral
Chemische Charakterisierung:Chemische Säure

TAGROW CO., LTD.

[Provinz: Beijing, China]

Anbieter Lieferant

Kasten-Bewegungs-Typ automatische Fluss-Satz-Maschine/Fluss-Verpackungs-Maschine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 25000.0-50000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:FFA
Verpackungsart:Tasche
Art:Automatische Verpackungsmaschine
Driven Type:Elektrisch
Anwendung:Getränke,Reinigung, Reinigungsmittel,Skin Care Produkte,Kosmetika,Hair Care Produkte,Milchprodukte,Tee,Gemüse Obst,Fisch, FleischSnack
Automatischer Grad:Automatisch

Küche-Tuch-Verpackungs-Maschinerie-Wärmeshrink-Papier-Paket-Maschine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 1.0-30000.0 / Stück
MOQ: 1 Stück

Modell Nr.:TPM680/150
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Doppelsiegelmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Intelligente vertikale Hochgeschwindigkeitsverpackmaschine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 7600.0-8300.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, CIP, CPT, FCA, EXW

Modell Nr.:CP420B-II
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Dichtung

Ameise-König Sex Capsule Sex Enhancer für Mann

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 2.8-3.0 / Stück
MOQ: 10 Stück

Modell Nr.:sp02
Herkunft:China (Festland
Coloer:Schwarz
Material:Flexible Kleber
Art:Sex Enhancer
Träger:männlich

Chase Dream Industrial Co., Limited

[Provinz: Guangdong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied

TrichlorisocyanurAcid/TCCA für Wasserbehandlungchemikalie

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 1023 / Ton
MOQ: 10 Tonnen
Handelsbedingungen: FOB, CFR, EXW, CIF, DAT, FAS, DDP, DAP, CIP, CPT, FCA

Modell Nr.:90%min
Aussehen:Pulver
Grade Norm:Reagent Grade
Säurestärke:Schwache Säure
Art:Anorganischen Säure
Qualität:Tech Grade

Landwirtschaftlicher Luft-Presse-Böe-Obstgarten-Sprüher für Trauben

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 1530.0-1730.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:3MZ - 650
Installation:Außengewinde Anschluss
Flüssigkeit enthalten:MedizinDesinfektor
Spritzform:Flüssigkeitssäule
Volumen:> 500 ml
Energieversorgung:Druck

Meizi Superenergien-Frucht, die Kapsel (KZ-SS027, abnimmt)

Ausgewählte Produkt des China-Lieferant

MOQ: 100 Stück
Handelsbedingungen: FOB, CFR, EXW, CIF, FCA

Modell Nr.:KZ-SS027
Anwendung:Zuhause
Einweg-:Nicht-Einweg-
Geschlecht:Unisex
Nebeneffekt:Nein
Verwendung:Für die orale Verabreichung

Kinzone International Industrial Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied

Sea Buckthorn Seed Oil Sea Buckthorn Seed Oil Softgel

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 100 / kg
MOQ: 1 kg
Handelsbedingungen: FOB, CFR, CIF, CIP, CPT

Modell Nr.:pure sea buckthorn seed oil
Rohstoff:Pflanzen
Warenzeichen:KINGHERBS
Verpackung:HDPE Drum for Oil, Carton for Softgel
Standard:SCFE-CO2 pure oil
Herkunft:China

Kingherbs Limited

[Provinz: Hunan, China]

Anbieter Lieferant

Auto-Stereolithographie des Android-6.0 für Nissans X-Schleppen 2015 mit Auto-Navigation

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 180.0-188.0 / Stück
MOQ: 1 Stück

Modell Nr.:XY-15NXT10
Kombination:GPS,Bluetooth,MP3/MP4 Player,Fernseher,RadioiPod
Platzierung:Armaturenbrett
Bescheinigung:CE,RoHS,FCCISO
Spannung:12/24V
Unterstützung Format:RMVB

Rote trockene Goji Beere Ningxia-

Ausgewählte Produkt des China-Lieferant

MOQ: 1 Ton

Modell Nr.:MEDLAR-8801
Bescheinigung:BRC,ISO,FDAHACCP
Verpackungsmaterial:Kunststoff
Speichermethode:Normal
Material:Agrarprodukte
Warenzeichen:Medlar

Heißer Gewicht-Verlust der Brandwunde-7, der Kapsel-Diät-Pillen abnimmt

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 3.0-3.5 / Stück
MOQ: 100 Stück

Modell Nr.:BT728
Anwendung:Zuhause
Einweg-:Einweg-
Geschlecht:Unisex
Nebeneffekt:Nein
Verwendung:Für die orale Verabreichung

Beauty Technology Co., Limited

[Provinz: Guangdong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied

Meizi Superenergien-Frucht, die Kapsel abnimmt

Ausgewählte Produkt des China-Lieferant

MOQ: 50 Stück
Handelsbedingungen: FOB

Modell Nr.:GSC053
Anwendung:Zuhause
Einweg-:Nicht-Einweg-
Geschlecht:Unisex
Nebeneffekt:Nein
Verwendung:Für die orale Verabreichung

Androide Auto-Navigation des Systems-6.0 für Ford Focus 2008 mit Auto-Spieler

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 180.0-188.0 / Stück
MOQ: 1 Stück

Modell Nr.:XY-08FF10
Kombination:GPS,Bluetooth,MP3/MP4 Player,Fernseher,RadioiPod
Platzierung:Armaturenbrett
Bescheinigung:CE,RoHS,FCCISO
Spannung:12/24V
Unterstützung Format:RMVB
1-10 11-20 21-30 31-40 41-50 ...
Brauchen Sie Hilfe?
Kontaktieren Sie bitte uns.
Verwandte Schnellsuche Kategorien
Als eine komplette Sourcing-Plattform aus einer Hand für Verpackungs- & Drucktechnik-Lieferanten, sind wir groß genug, um mit der notwendigen Konstruktionskapazität eine erweiterte Produktlinie von Etiketten und Verpackungen anbieten zu können, zugleich aber klein genug, um eine persönliche Betreuung zu bieten, welche auch heute im Geschäftsleben so überaus wichtig ist. Wir bieten Ihnen nicht nur qualitativ hochwertige Etiketten und Verpackungen sondern wertvolle Lösungen. Technologien entwickeln sich fortlaufend weiter, und so auch unsere Lieferanten, die ihre Standards stets auf hohem Niveau halten und in allen Bereichen Innovationen vorantreiben. Angefangen bei ihren Strategien und Endprodukten bis hin zu Fragen hinsichtlich Umwelterhaltung und Umweltschutz. Wir bieten globalen Einkäufern eine vollständige Ressource für ihren Verpackungsbedarf, wie z. B. Obst- Zelle fabrik. Darüberhinaus finden Sie weitere Verpackungs- und Drucklösungen, wie z. B. frucht, lebensmittel,, obst, obstverarbeitung zu wettbewerbsfähigen Preisen. Lassen Sie uns Ihnen helfen, unsere wertschöpfenden Produktangebote in Anspruch zu nehmen, um Ihren hohen Heimatmarkt- und Kundenbedürfnissen zu genügen.
Schnellproduktverzeichnis