Startseite » Verpackung und Druck » Verpackungskiste » Obst- Zelle
Schnellproduktverzeichnis Schnelllieferantenverzeichnis
Seite 3/332  
Insgesamt 9956 Produkte von etwa 711

Obst- Zelle

Hersteller & Lieferanten
China-Lieferant - Gold-Mitglied
Sortieren nach: Relevanz
Zeigen: 30 artikel

Edelstahl-mischender Sammelbehälter für Nahrung und Kosmetik (ACC-140)

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 1500.0-2000.0 / Stück
MOQ: 1 Stück

Modell Nr.:ACC-140
Warenzeichen:TotalPacks
Verpackung:Tri-Ply Wood
Herkunft:China

Wenzhou Totalpacks Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied

Erdnuss-Kerne

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 1200 / Ton
MOQ: 20 Tonnen
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:24/28
Art:Erdnuss
Verarbeitung:Roh
Warenzeichen:rzjy
Verpackung:Mesh Bag
Standard:Top Quality

Rizhao Jiuyu Export & Import Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

Automatisches Zellophan, das Verpackung-Maschine für Duftstoff, Zigarette, Tee, medizinischer, ...

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 16000.0-23000.0 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:FFT
Verpackungsart:Tasche
Art:Automatische Verpackungsmaschine
Driven Type:Elektrisch
Anwendung:Getränke,Reinigung, Reinigungsmittel,Skin Care Produkte,Kosmetika,Hair Care Produkte,Milchprodukte,Tee,Gemüse Obst,Fisch, FleischSnack
Automatischer Grad:Automatisch

Pflanze oder Animal Source 80% Free Amino Acid

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 1500 / Ton
MOQ: 2 Tonnen
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:AA80
Infektion auf Boden:Physiologischen Neutral
Chemical Character:Chemische Neutral
Aussehen:Pulver
Releasetyp:Schnell
Klassifikation:Stickstoff-Dünger

Qingdao Future Group

[Provinz: Shandong, China]

Anbieter Lieferant

Maschine-Düngemittel-Spreizer CDR-1000

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 345.0-365.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:CDR-1000
Anwendung:Weizen,Reis,Mais,Erdnuss,Knollen,Bohnen,BäumeObst
Application Field:LandwirtschaftForstwirtschaft
Funktion:Befruchtung
Pflanzmaschine Typ:Pflanzmaschine
Düngemaschinentyp:Full-Size-Dünger

Spitzentee Tieguanyin Bienen-Blütenstaub des blütenstaub-100%Natrual, keine Antibiotika, keine ...

Ausgewählte Produkt des China-Lieferant

MOQ: 100 Boxen
Handelsbedingungen: FOB, CFR, CIF, CPT

Modell Nr.:YYFHF-TGYNO: 01
Stil:Rein
Verarbeitungsart:Rein
Verpackung:Bottle/Box
Standard:SGS
Herkunft:China

MiniScale Essential Oil Extractor Equipment mit Highquality

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 7358 / set
MOQ: 1 set
Handelsbedingungen: FOB, CIF

Modell Nr.:yc-020
Kundenspezifische:Kundenspezifische
Material:Rostfreier Stahl
Bescheinigung:CE
Anwendung:Schule,HosipitalLabor
Warenzeichen:Pilotech

Getrocknete Goji Beeren Ningxia-Qualität (WolfBerry)

Ausgewählte Produkt des China-Lieferant

MOQ: 5 Tonnen
Handelsbedingungen: FOB, CIF, EXW

Modell Nr.:Normal Dried Goji Berry
Bescheinigung:ISO,FDAHACCP
Speichermethode:Normal
Haltbarkeit:> 12 Monate
Warenzeichen:zhengqiyuan
Verpackung:100g, 250, 500, 5kg, 10kg, 20kg

Heiße verkaufende neue Entwurfs-Panda-Digital-Babywaage

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 20.0-24.0 / Stück
MOQ: 100 Stück

Modell Nr.:NS-BBS03
Anzeigetyp:LCD
Lage:Plattformwaage
Mass-Methode:Automatisch
Funktion:Waage
Struktur:Elektronische Waage

Ebene-u. Schultaschen-Papiertüten, die Maschine Wfd-400 herstellen

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 45.0-55.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:WFD-400
Verwendung:Brotbeutel
Eigenschaft:Automatische Kleber
Material:Papier
Breite:80-250
Maschinentyp:Schlauchbeutelmaschine

Jiangsu Nanjiang Machinery Co., Ltd.

[Provinz: Jiangsu, China]

Anbieter Lieferant

Elektrische Heizungs-industrielle trocknende Gemüsemaschine für Verkauf

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 3500.0-15000.0 / Stück
MOQ: 1 Stück

Modell Nr.:CT-C-III
Struktur:Air Flow Drier
Operative Verfahren:Kontinuierlich
Betriebsdruck:Atmosphärische Dryer
Trocknungsmedium:Luft
Aussehen getrocknete Probe:Masse

Intelligente vertikale Hochgeschwindigkeitsverpackmaschine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 7600.0-8300.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, CIP, CPT, FCA, EXW

Modell Nr.:CP420B-II
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Dichtung

Edelstahl- Homogenisator mit unterschiedlichen Arbeitsdruck

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 2000.0-10000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:LH-H Series
Anwendung:Milch,JoghurtKäse
Warenzeichen:LIHONG
Verpackung:Wooden Package, Fix in Container, etc
Standard:iso
Herkunft:China

40% Aminosäure-Puder (AminoGrow 40)

Ausgewählte Produkt des China-Lieferant

MOQ: 3 Tonnen
Handelsbedingungen: CFR

Modell Nr.:40% Amino Acid ( SO4 Base )
Zertifizierung:ISO9001
Anwendung:Gemüse,BlumenFrucht
Aussehen:Pulver
Infektion auf Boden:Physiologische Neutral
Chemische Charakterisierung:Chemische Säure

TAGROW CO., LTD.

[Provinz: Beijing, China]

Anbieter Lieferant

Ameise-König Sex Capsule Sex Enhancer für Mann

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 2.8-3.0 / Stück
MOQ: 10 Stück

Modell Nr.:sp02
Herkunft:China (Festland
Coloer:Schwarz
Material:Flexible Kleber
Art:Sex Enhancer
Träger:männlich

Chase Dream Industrial Co., Limited

[Provinz: Guangdong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied

26 Inch-Screen-Verkaufäutomat

Ausgewählte Produkt des China-Lieferant

MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, EXW, CIF, DDP, DAP

Modell Nr.:LY-511CNR10800
Art:Essen und Trinken
Umweltzustand:Innen-
Charge System:Credit Card
Funktion:Kühlung
Touchscreen:Touch-Screen

Rote Goji Beeren Ningxia-

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 6.23 / kg
MOQ: 500 kg

Modell Nr.:MEDLAR-88001
Lagerung:Schatten
Haltbarkeit:24 Monate
Nährzusammensetzung:Aminosäure,Eiweiß,VitaminMineral
Form:Indehiscent
Trocknungsprozess:AD

Küche-Tuch-Verpackungs-Maschinerie-Wärmeshrink-Papier-Paket-Maschine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 1.0-30000.0 / Stück
MOQ: 1 Stück

Modell Nr.:TPM680/150
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Doppelsiegelmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

TrichlorisocyanurAcid/TCCA für Wasserbehandlungchemikalie

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 1023 / Ton
MOQ: 10 Tonnen
Handelsbedingungen: FOB, CFR, EXW, CIF, DAT, FAS, DDP, DAP, CIP, CPT, FCA

Modell Nr.:90%min
Aussehen:Pulver
Grade Norm:Reagent Grade
Säurestärke:Schwache Säure
Art:Anorganischen Säure
Qualität:Tech Grade

Landwirtschaftlicher Luft-Presse-Böe-Obstgarten-Sprüher für Trauben

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 1530.0-1730.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:3MZ - 650
Installation:Außengewinde Anschluss
Flüssigkeit enthalten:MedizinDesinfektor
Spritzform:Flüssigkeitssäule
Volumen:> 500 ml
Energieversorgung:Druck

Sea Buckthorn Seed Oil Sea Buckthorn Seed Oil Softgel

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 100 / kg
MOQ: 1 kg
Handelsbedingungen: FOB, CFR, CIF, CIP, CPT

Modell Nr.:pure sea buckthorn seed oil
Rohstoff:Pflanzen
Warenzeichen:KINGHERBS
Verpackung:HDPE Drum for Oil, Carton for Softgel
Standard:SCFE-CO2 pure oil
Herkunft:China

Kingherbs Limited

[Provinz: Hunan, China]

Anbieter Lieferant

Schrumpfverpackung/Verpackungs-Maschine (FFB) für Flasche, schnelle Nudel

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 16000.0-17000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB

Modell Nr.:FFB
Anwendung:Lebensmittel,Ware,Machinery & Hardware,Chemikalie,Geschenke & ArtsMedizinisch
Verpackung:Film
Automatischer Grad:Automatisch
Driven Typ:Elektrisch
Stellen Sie Schnell:Elektronische Drehzahlregelung

Hoher Reinheitsgrad-organisches Düngemittel-Meerespflanze-Auszug-Puder

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 1000.0-2000.0 / Ton
MOQ: 1 Ton
Handelsbedingungen: FOB

Modell Nr.:ALGA WS100
Klassifikation:Organische Dünger
Releasetyp:Schnell
Aussehen:Pulver
Warenzeichen:QFG
Verpackung:as Client' S Requirments

Qingdao Future Group

[Provinz: Shandong, China]

Anbieter Lieferant

Qualität von Seaweed Extract Fertilizer (Seaweed Caboron)

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 10000 / liters
MOQ: 3000 liters
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:Seaweed Caboron
Warenzeichen:SEAWINNER
Verpackung:100ml, 250ml, 500ml, 1L, 4L, 5L, 10L
Herkunft:Qingdao, China

Qingdao Seawin Biotech Group Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

Epistar Chip hohe Leistung 1000W LED Grow Light Full Spectrum für Greenhouse

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 249 / Stück
MOQ: 2 Stück
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:WYP9100-1000W
Anwendung:Obst und Gemüse,Flowers,Sonderkulturen,Belaubt,ObstSämling
IP-Schutzklassen:IP54
Form:Quadratisch
Garantie:2 Jahre
Leben:50000h

Shenzhen Victory Lighting Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Löslicher Meerespflanze-Auszug (SeaTop), Meerespflanze-Düngemittel

Ausgewählte Produkt des China-Lieferant

MOQ: 1 Ton
Handelsbedingungen: CFR

Modell Nr.:Seaweed Extract
Zertifizierung:ISO9001
Anwendung:Gemüse,BlumenFrucht
Infektion auf Boden:Physiologische Neutral
Chemische Charakterisierung:Chemische Alkaline
Freigabe Typ:Schnell

TAGROW CO., LTD.

[Provinz: Beijing, China]

Anbieter Lieferant

Milch-Tee-CupShrink Pakcing Maschine

Ausgewählte Produkt des China-Lieferant

MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:SFR
Verpackungsart:Tasche
Art:Automatische Verpackungsmaschine
Driven Type:Elektrisch
Anwendung:Getränke,Reinigung, Reinigungsmittel,Skin Care Produkte,Kosmetika,Öl,Hair Care ProdukteMilchprodukte
Automatischer Grad:Automatisch

Kiefer-Haut-Auszug mit 95% Proanthocyanidins

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 18 / kg
MOQ: 1 kg

Modell Nr.:GS-06
Zertifizierung:RoHS,SGS,BRC,ISO,FDAHACCP
Assay-Verfahren:HPLC-MS,GPC,HPLCUV
Anmeldeformular:Injektion,Lotion,Zäpfchen,Paste,TabletteKapsel
Anwendung:Essen,Health Care ProdukteMedizin
Bundesland:Pulver

Flüssige Aminosäure + 3% Kupfer

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 1300 / Ton
MOQ: 1 Ton
Handelsbedingungen: FOB, CFR, CIF, DAT, FAS, DDP, DAP, CIP, CPT, FCA, EXW

Modell Nr.:Topusing AA+C
Aussehen:Flüssigkeit
Releasetyp:Schnell
Klassifikation:Spurenelement Dünger
Art:Kompost
Warenzeichen:TOPUSING

Gute Qualitätsmeerespflanze-Auszug Powde18% mit gutem Preis

Ausgewählte Produkt des China-Lieferant

MOQ: 1 Stück

Modell Nr.:18%
Klassifikation:Organische Dünger
Releasetyp:Langsam
Infektion auf Boden:Physiologischen Neutral
Chemical Character:Chemische Neutral
Aussehen:Pulver

Hangzhou Anxing Trade Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

1-10 11-20 21-30 31-40 41-50 ...
Brauchen Sie Hilfe?
Kontaktieren Sie bitte uns.
Verwandte Schnellsuche Kategorien
Als eine komplette Sourcing-Plattform aus einer Hand für Verpackungs- & Drucktechnik-Lieferanten, sind wir groß genug, um mit der notwendigen Konstruktionskapazität eine erweiterte Produktlinie von Etiketten und Verpackungen anbieten zu können, zugleich aber klein genug, um eine persönliche Betreuung zu bieten, welche auch heute im Geschäftsleben so überaus wichtig ist. Wir bieten Ihnen nicht nur qualitativ hochwertige Etiketten und Verpackungen sondern wertvolle Lösungen. Technologien entwickeln sich fortlaufend weiter, und so auch unsere Lieferanten, die ihre Standards stets auf hohem Niveau halten und in allen Bereichen Innovationen vorantreiben. Angefangen bei ihren Strategien und Endprodukten bis hin zu Fragen hinsichtlich Umwelterhaltung und Umweltschutz. Wir bieten globalen Einkäufern eine vollständige Ressource für ihren Verpackungsbedarf, wie z. B. Obst- Zelle fabrik. Darüberhinaus finden Sie weitere Verpackungs- und Drucklösungen, wie z. B. frucht, lebensmittel,, obst, obstverarbeitung zu wettbewerbsfähigen Preisen. Lassen Sie uns Ihnen helfen, unsere wertschöpfenden Produktangebote in Anspruch zu nehmen, um Ihren hohen Heimatmarkt- und Kundenbedürfnissen zu genügen.
Schnellproduktverzeichnis