Startseite » Produktionsmaschinen » Biegemaschine » Maschinensteuerung
Schnellproduktverzeichnis Schnelllieferantenverzeichnis
Seite 1120/6515  
Insgesamt 195430 Produkte von etwa 5428

Maschinensteuerung

Hersteller & Lieferanten
China-Lieferant - Gold-Mitglied
Sortieren nach: Relevanz
Zeigen: 30 artikel

Automatischer Kissen-Typ Paket-Maschine backt Mond-Kuchen-Brot zusammen

Einheitspreis: US $ 6805.0-16000.0 / Stück
MOQ: 1 Stück

Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Und Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung
Driven Type:Elektrisch

Wenzhou Kotek Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Automatische Zuckerwatte-Biskuit-Nahrungsmittelverpackung

Einheitspreis: US $ 6805.0-16000.0 / Stück
MOQ: 1 Stück

Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Und Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung
Driven Type:Elektrisch

Wenzhou Kotek Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Automatische Zuckerwatte-Biskuit-Nahrungsmittelpaket-Maschinerie

Einheitspreis: US $ 6805.0-16000.0 / Stück
MOQ: 1 Stück

Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Und Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung
Driven Type:Elektrisch

Wenzhou Kotek Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Mond-Kuchen-automatische Paket-Hochgeschwindigkeitsmaschine

Einheitspreis: US $ 4900.0-9800.0 / Stück
MOQ: 1 Stück

Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Gemüse Obst,Fisch, Fleisch,SnackGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung
Driven Type:Elektrisch

Wenzhou Kotek Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Mond-Kuchen-automatische Hochgeschwindigkeitsverpackungsmaschine

Einheitspreis: US $ 4900.0-9800.0 / Stück
MOQ: 1 Stück

Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Gemüse Obst,Fisch, Fleisch,SnackGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung
Driven Type:Elektrisch

Wenzhou Kotek Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Mond-Kuchen-automatische Hochgeschwindigkeitsverpackmaschine

Einheitspreis: US $ 4900.0-9800.0 / Stück
MOQ: 1 Stück

Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Gemüse Obst,Fisch, Fleisch,SnackGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung
Driven Type:Elektrisch

Wenzhou Kotek Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Horizontale Protein-Hochgeschwindigkeitsstab-Verpackmaschine

Einheitspreis: US $ 4900.0-9800.0 / Stück
MOQ: 1 Stück

Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Gemüse Obst,Fisch, Fleisch,SnackGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung
Driven Type:Elektrisch

Wenzhou Kotek Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Kissen-Typ Plastikfilm-Fluss-Verpackmaschine für Käse

Einheitspreis: US $ 6805.0-16000.0 / Stück
MOQ: 1 Stück

Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Gemüse Obst,Fisch, Fleisch,SnackGewürz
Art:Und Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung
Driven Type:Elektrisch

Wenzhou Kotek Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Kotek Hochgeschwindigkeitsverpackungsmaschine für Tuch

Einheitspreis: US $ 4900.0-9800.0 / Stück
MOQ: 1 Stück

Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Gemüse Obst,Fisch, Fleisch,SnackGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung
Driven Type:Elektrisch

Wenzhou Kotek Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Fluss-automatische Süßigkeit-Verpackmaschine

Einheitspreis: US $ 4900.0-9800.0 / Stück
MOQ: 1 Stück

Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Gemüse Obst,Fisch, Fleisch,SnackGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung
Driven Type:Elektrisch

Wenzhou Kotek Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Fluss-automatische verpackenverpackungs-Maschinen

Einheitspreis: US $ 4900.0-9800.0 / Stück
MOQ: 1 Stück

Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Gemüse Obst,Fisch, Fleisch,SnackGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung
Driven Type:Elektrisch

Wenzhou Kotek Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Kissen-Beutel-Fluss-automatische Verpackungs-Maschine

Einheitspreis: US $ 6805.0-16000.0 / Stück
MOQ: 1 Stück

Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Gemüse Obst,Fisch, Fleisch,SnackGewürz
Art:Und Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung
Driven Type:Elektrisch

Wenzhou Kotek Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Cer Sdandard horizontale volle automatische Granola-Stab-Verpackmaschine

Einheitspreis: US $ 4900.0-9800.0 / Stück
MOQ: 1 Stück

Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Gemüse Obst,Fisch, Fleisch,SnackGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung
Driven Type:Elektrisch

Wenzhou Kotek Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Horizontale Messer-Multifunktionsverpackungsmaschinen

Einheitspreis: US $ 4900.0-9800.0 / Stück
MOQ: 1 Stück

Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Gemüse Obst,Fisch, Fleisch,SnackGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung
Driven Type:Elektrisch

Wenzhou Kotek Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Heißer Verkaufs-horizontale automatische Nahrungsmittelverpackungs-Maschine für Verkauf

Einheitspreis: US $ 6805.0-16000.0 / Stück
MOQ: 1 Stück

Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Und Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung
Driven Type:Elektrisch

Wenzhou Kotek Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Leistungsfähiger vielseitiger automatischer Käse-Verpackmaschinen

Einheitspreis: US $ 6805.0-16000.0 / Stück
MOQ: 1 Stück

Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Gemüse Obst,Fisch, Fleisch,SnackGewürz
Art:Und Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung
Driven Type:Elektrisch

Wenzhou Kotek Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Laborminikegel-Garn-Wicklungs-Maschine

MOQ: 1 set

Modell Nr.:DW7060H
Verwendung:Universal Textile Testing
Automatischer Grad:Automatische
Stoff Stil Testing Machine Type:Stoff Gleichmäßigkeit der Oberfläche Detector
Bescheinigung:CE
Zustand:New

Hefei Fanyuan Instrument Co., Ltd.

[Provinz: Anhui, China]

Anbieter Lieferant

Minilaborkegel-Wicklungs-Maschine

MOQ: 1 set

Modell Nr.:DW7060H
Verwendung:Universal Textile Testing
Automatischer Grad:Automatische
Stoff Stil Testing Machine Type:Stoff Gleichmäßigkeit der Oberfläche Detector
Bescheinigung:CE
Zustand:New

Hefei Fanyuan Instrument Co., Ltd.

[Provinz: Anhui, China]

Anbieter Lieferant

Magnetische Puder-Kupplung 5kg 50nm Tl50A-1 für manuellen Spannkraft-Controller

Einheitspreis: US $ 159 / Stück
MOQ: 10 Stück

Modell Nr.:Tl50A-1
Bescheinigung:SGS,ISO 9001ISO
Kategorie:Tension Control System
Warenzeichen:True engin
Verpackung:Wooden Box
Standard:50NM

Sany Sy235 25 Tonnen-mittlerer Exkavator-Preis des hydraulischen Exkavators

MOQ: 1 Stück

Modell Nr.:SY235
Art:Raupenbagger
Verwendung:Spezialbagger,Meeres BaggerBergbau Bagger
Eimer:Bagger
Übertragung:Hydraulisch Getriebe
Antriebsart:Verbrennungsantrieb

SANY GROUP CO., LTD.

[Provinz: Hunan, China]

Anbieter Lieferant

Sany Sy235 25 Tonnen-mittlerer Gleisketten-Exkavator-neuer Exkavator-Preis

MOQ: 1 Stück

Modell Nr.:SY235
Art:Raupenbagger
Verwendung:Spezialbagger,Meeres BaggerBergbau Bagger
Eimer:Bagger
Übertragung:Hydraulisch Getriebe
Antriebsart:Verbrennungsantrieb

SANY GROUP CO., LTD.

[Provinz: Hunan, China]

Anbieter Lieferant

Sany Sy215 21.5 t-mittlere Gleisketten-hydraulischer Exkavator

MOQ: 1 Stück

Modell Nr.:SY215
Art:Raupenbagger
Verwendung:Spezialbagger,Meeres BaggerBergbau Bagger
Eimer:Bagger
Übertragung:Hydraulisch Getriebe
Antriebsart:Verbrennungsantrieb

SANY GROUP CO., LTD.

[Provinz: Hunan, China]

Anbieter Lieferant

Sany Sy235 25 Tonnen-heißer Verkaufs-mittlerer Exkavator mit Wanne

MOQ: 1 Stück

Modell Nr.:SY235
Art:Raupenbagger
Verwendung:Spezialbagger,Meeres BaggerBergbau Bagger
Eimer:Bagger
Übertragung:Hydraulisch Getriebe
Antriebsart:Verbrennungsantrieb

SANY GROUP CO., LTD.

[Provinz: Hunan, China]

Anbieter Lieferant

Sany Sy235 23.5 des Brennstoffersparnis-Tonnen König-Crawler Excavator

MOQ: 1 Stück

Modell Nr.:SY235
Art:Raupenbagger
Verwendung:Spezialbagger,Meeres BaggerBergbau Bagger
Eimer:Bagger
Übertragung:Hydraulisch Getriebe
Antriebsart:Verbrennungsantrieb

SANY GROUP CO., LTD.

[Provinz: Hunan, China]

Anbieter Lieferant

Sany Sy235 25 Tonnen-Exkavator-grabendes Maschinen-Grabungs-Baggergerät

MOQ: 1 Stück

Modell Nr.:SY235
Art:Raupenbagger
Verwendung:Spezialbagger,Meeres BaggerBergbau Bagger
Eimer:Bagger
Übertragung:Hydraulisch Getriebe
Antriebsart:Verbrennungsantrieb

SANY GROUP CO., LTD.

[Provinz: Hunan, China]

Anbieter Lieferant

Sany Sy235 25 Tonnen-mittlerer Exkavator-hydraulischer Massen-Urheber 870k

MOQ: 1 Stück

Modell Nr.:SY235
Art:Raupenbagger
Verwendung:Spezialbagger,Meeres BaggerBergbau Bagger
Eimer:Bagger
Übertragung:Hydraulisch Getriebe
Antriebsart:Verbrennungsantrieb

SANY GROUP CO., LTD.

[Provinz: Hunan, China]

Anbieter Lieferant

Sany Sy215 21.5 t-mittlere Gleisketten-hydraulischer Exkavator-Massen-Urheber

MOQ: 1 Stück

Modell Nr.:SY215
Art:Raupenbagger
Verwendung:Spezialbagger,Meeres BaggerBergbau Bagger
Eimer:Bagger
Übertragung:Hydraulisch Getriebe
Antriebsart:Verbrennungsantrieb

SANY GROUP CO., LTD.

[Provinz: Hunan, China]

Anbieter Lieferant

Sany Sy215 21.5 t-mittlerer hydraulischer Exkavator

MOQ: 1 Stück

Modell Nr.:SY215
Art:Raupenbagger
Verwendung:Spezialbagger,Meeres BaggerBergbau Bagger
Eimer:Bagger
Übertragung:Hydraulisch Getriebe
Antriebsart:Verbrennungsantrieb

SANY GROUP CO., LTD.

[Provinz: Hunan, China]

Anbieter Lieferant

Sany Sy215 21.5 t-Gleisketten-hydraulischer Exkavator

MOQ: 1 Stück

Modell Nr.:SY215
Art:Raupenbagger
Verwendung:Spezialbagger,Meeres BaggerBergbau Bagger
Eimer:Bagger
Übertragung:Hydraulisch Getriebe
Antriebsart:Verbrennungsantrieb

SANY GROUP CO., LTD.

[Provinz: Hunan, China]

Anbieter Lieferant

Sany Sy215 21.5 t-mittlerer Gleisketten-Exkavator

MOQ: 1 Stück

Modell Nr.:SY215
Art:Raupenbagger
Verwendung:Spezialbagger,Meeres BaggerBergbau Bagger
Eimer:Bagger
Übertragung:Hydraulisch Getriebe
Antriebsart:Verbrennungsantrieb

SANY GROUP CO., LTD.

[Provinz: Hunan, China]

Anbieter Lieferant

Brauchen Sie Hilfe?
Kontaktieren Sie bitte uns.
Verwandte Schnellsuche Kategorien
Haben Sie Schwierigkeiten bei der Suche nach Maschinensteuerung fabrik und zuverlässigen Partnern in China? Eine Lösung kann hier, in unserer umfassenden und aktualisierten Datenbank führender chinesischer Maschinenhersteller, gefunden werden. Eine große Anzahl qualifizierter Zulieferer der Fertigungs- & Verarbeitungsindustrie werden Ihnen ihre neuesten Maschinen und Technologien präsentieren. Wie wir wissen, beinhaltet die Suche nach guten Lieferanten viel mehr als das Scannen einer Reihe von Preislisten. Die richtige Internet-Handelsplattform auszuwählen, kann das wertvollste Instrument im Streben nach wirtschaftlichem Erfolg und Expansion sein. Unsere Webseite ist ein weltweit führendes B2B-Portal, auf dem unsere Mitglieder eine breite Auswahl an Qualitätsmaschinen und Anlagen präsentieren. Sie bieten außerdem Hightech-Maschinen und Werkzeuge, angefangen bei auswirkungen maschine, druckregler, motor-drehzahlsteller. Wir heißen alle globalen Einkäufer willkommen, um mit Anbietern aus China für eine glänzende Zukunft zusammenzuarbeiten. Seriös, Zuverlässig & Innovativ. Große Produktvielfalt. Erkundigen Sie sich jetzt bei unseren Lieferanten.
Schnellproduktverzeichnis