Startseite » Verpackung und Druck » Verpackung Tablett » Papiertrommel
Schnellproduktverzeichnis Schnelllieferantenverzeichnis
Seite 55/1102  
Insgesamt 33031 Produkte von etwa 1943

Papiertrommel

Hersteller & Lieferanten
China-Lieferant - Gold-Mitglied
Sortieren nach: Relevanz
Zeigen: 30 artikel

Qualitäts-Polyluftblasen-Werbungs-Maschine

Einheitspreis: US $ 10000.0-50000.0 / Set
MOQ: 1 Set

Warenzeichen:SCM
Verpackung:Packed by Pallet
Standard:8000*3900*2600mm
Herkunft:Zhejiang, China
HS-Code:84412000
Produktionskapazität:5 Set /Month

Automatisches Flexo Printing Slotting und Sterben-Cutting Machine

Einheitspreis: US $ 15000.0-350000.0 / Set
MOQ: 1 Set

Modell Nr.:GYMK
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Milchprodukte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Und Verschließmaschine
Enden Spezies:Box Molding
Bildungsfunktion:Bildung

Volle automatische Kennsatzshrink-Hülsen-Maschine des Zylinder-20L

Einheitspreis: US $ 9500.0-15000.0 / Set
MOQ: 1 Set

Modell Nr.:150
Automatischer Grad:Automatisch
Anwendung:Kosmetika,Getränke,Reinigung, Reinigungsmittel,Skin Care Produkte,ÖlMilchprodukte
Art:Sleeve Etikettiermaschine
Driven Type:Elektrisch
Klassifikation:Automatische vertikale runde Flaschen-Etikettiermaschine

Shanghai Nancheng Machinery Co., Ltd.

[Provinz: Shanghai, China]

Anbieter Lieferant

Lithographische Offsetdrucken-Platte CTP

Einheitspreis: US $ 3.5 / Square Meter
MOQ: 5000 Quadratmeter
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:K1
Material:Aluminium
Verwendung:Offsetdruck
Art:CTP Platte
Stil:Positiv
Warenzeichen:CXK or OEM service

Luftbündel-Kabel ABC-obenliegendes ABC-Kabel

Einheitspreis: US $ 1 / Metro
MOQ: 1000 Meter

Modell Nr.:ABC cable
Art:Isolierte
Leitertyp:Stranded
Anwendung:Oben
Leitermaterial:Aluminium
Isoliermaterial:XLPE

People's Cable Group Co., Ltd.

[Provinz: Henan, China]

Anbieter Lieferant

Kompatibel für Toner-Kassetten-Kopierer-Laser XEROX-Cocucolor 3535

Einheitspreis: US $ 3.0-15.0 / Set
MOQ: 10 Sets

Modell Nr.:for Xerox cocucolor 3535
Für OEM Marke:Xerokopieren
Feature:Kompatibel
Warenzeichen:CAIRE
Verpackung:Netural / Customerized
Herkunft:China

Caire (Shenzhen) Digital Tech Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Gutes Quality mit Competitive Price Caustic Soda Pearls

Einheitspreis: US $ 420 / Ton
MOQ: 27 Tonnen
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:99%
Klassifikation:Ätznatron
Aussehen:Pearls
Grade Norm:Industrial Grade
Solubleness:Löslichen Alkali
Lonisationsvermögen:Starke Alkali

Lebensmittel-Zusatzstoffe L-Arginin (CAS: 74-79-3)

Einheitspreis: US $ 119.0-198.0 / Ton
MOQ: 20 Tonnen

Modell Nr.:salus
Verpackungsmaterial:Papier
Speichermethode:Normal
Haltbarkeit:> 12 Monate
Nährzusammensetzung:Protein
Ressource:Natürliche

GMP zugelassenes Vitamin A +D Softgel

Einheitspreis: US $ 0.1 / Stück
MOQ: 380000 Stück

Modell Nr.:1000mg
Funktion:KaterSenkung des Blutdrucks
Bescheinigung:GMP,ISO,HACCPKOSHER
Altersgruppe:Erwachsene
Art:Kapsel
Geschlecht:Unisex

RoHS 6mm 304 Edelstahl Balls für Nail Polish

Einheitspreis: US $ 7.0-8.0 / kg
MOQ: 20 kg
Handelsbedingungen: FOB, CFR, CIF, DAT, FAS, DDP, DAP, CIP, CPT, FCA, EXW

Modell Nr.:304 STAINLESS STEEL BALLS 6MM
Kundenspezifische:Kundenspezifische
Normteile:Ja
Universal:Ja
Material:Rostfreier Stahl
Warenzeichen:SAIGE

Changzhou Feige Steel Ball Co., Ltd.

[Provinz: Jiangsu, China]

Anbieter Lieferant

Fabrik-Preis-Ameisensäure 85% 90% 94%

Einheitspreis: US $ 460 / Ton
MOQ: 1 Ton

Modell Nr.:Tech Grade
Alkyl No.:Gesättigten Säure
Aussehen:Flüssigkeit
Quelle:Hydrolyse
Farbe:Transparent
Warenzeichen:TJXT

Fördernde Produkt-China-Öl-Trommel-emballierengroßhandelsmaschine

Einheitspreis: US $ 2000.0-5000.0 / Set
MOQ: 1 Set

Modell Nr.:KWL-BT40
Warenzeichen:KWELL
Verpackung:Seaworthy Packing
Standard:900*900*2500mm
Herkunft:Zhangjiagang, China
HS-Code:84778000

Spectraflair ganz eigenhändig geschrieber Funkeln-Puder-Hersteller

Einheitspreis: US $ 201.5-530.5 / kg
MOQ: 1 kg

Modell Nr.:KT-Glitter Powder
Verwendung:Malen,Kosmetikum,Leder,TintePapier
Art:Natürlich
Löslichkeit:Unlöslichkeit
Warenzeichen:KOLORTEK
Verpackung:Carton/Drum

Kolortek Co., Ltd.

[Provinz: Jiangsu, China]

Anbieter Lieferant

TUV 6mm2 Solar PV Mc4 Connector Cable

Einheitspreis: US $ 0.35-0.6 / Metro
MOQ: 1000 Meter

Modell Nr.:pv1-f
Material Form:Runddraht
Leitermaterial:XLPE
Leitertyp:Stranded
Zertifizierung:TÜV
Warenzeichen:JOCA

Shanghai Jiukai Wire & Cable Co., Ltd.

[Provinz: Shanghai, China]

Anbieter Lieferant

Drucken-Serviette-Papiermaschine der Farben-zwei in China

Einheitspreis: US $ 1.0-15000.0 / Set
MOQ: 1 Set

Modell Nr.:XY-OQ-7000A
Art:Drum Type
Echtlaufgeschwindigkeit:500-600PCS / min
Automatischer Grad:Automatisch
Bescheinigung:CE
Zustand:Neu

Glcj F900 Serviette druckte geprägte Maschinen-Serviette-faltende Maschine

Einheitspreis: US $ 10000.0-30000.0 / Set
MOQ: 1 Set

Modell Nr.:GLCJ-F900
Art:Drum Type
Echtlaufgeschwindigkeit:> 800PCS / min
Automatischer Grad:Automatisch
Bescheinigung:CE,ISOSGS
Zustand:Neu

Weifang Greatland Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

Qualitäts-Protokoll-Teiler-hölzerner Abklopfhammer

Einheitspreis: US $ 6000.0-12000.0 / Stück
MOQ: 1 Stück

Modell Nr.:2118
Objekt:Holz
Crushing Degree:Grob Crusher
Crushing Stil:Extrudieren
Prinzip:Zylinder Culling
Schneidstoff:High-Speed ​​Steel

Kompatible OPC-Trommel für HP 2035 mit Patent geben Gang frei

MOQ: 50 PIECE

Modell Nr.:for HP 2035
Für OEM Marke:HP
Warenzeichen:gantech
Verpackung:Neutral Packing
Herkunft:Jiangsu China
HS-Code:8443999010

Hochgeschwindigkeitskarton-Drucken und kerbende Maschine

Einheitspreis: US $ 15000.0-350000.0 / Set
MOQ: 1 Set

Modell Nr.:1200*2800
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Milchprodukte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Und Verschließmaschine
Enden Spezies:Box Molding
Bildungsfunktion:Bildung

Bottich-Farben-Blau-Bc Bottich-Blau 6

Einheitspreis: US $ 8.28-8.78 / kg
MOQ: 100 kg

Modell Nr.:69825
Farbe:Blau
Aussehen:Pulver
Verwendung:Malen,Kunststoff,Leder,Tinte,Papier,Textil-Lebensmittel
Applikation Material:Wolle
Inhalt:100%

Hangzhou Emperor Chemical Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Fhqr Serien-Hochgeschwindigkeitsplastikfilm-aufschlitzende Maschine

Einheitspreis: US $ 4000.0-22000.0 / Stück
MOQ: 1 Stück

Modell Nr.:FHQR-800/1100/1300
Art:Breitband-Schneidemaschine
Arbeitsmethode:Round Messer Cutting
Struktur:Schneidteil
Verpackung:Film
Anwendbares Verfahren:Prozessmaterialien

Natürliches AAC/ACSR/AAAC obenliegend zusammengerolltes Kabel ABC-Luftkabel

Einheitspreis: US $ 1 / Metro
MOQ: 1000 Meter

Modell Nr.:ABC
Art:Isolierte
Leitertyp:Stranded
Anwendung:Oben
Leitermaterial:Aluminium
Isoliermaterial:XLPE

People's Cable Group Co., Ltd.

[Provinz: Henan, China]

Anbieter Lieferant

Kompatibel für Toner-Kassette XEROX-Phaser 7500 Workcentre

Einheitspreis: US $ 2.0-15.0 / Set
MOQ: 10 Sets

Modell Nr.:for Xerox phaser 7500
Für OEM Marke:Xerokopieren
Feature:Kompatibel
Warenzeichen:CAIRE
Verpackung:Netural / Customerized
Herkunft:China

Caire (Shenzhen) Digital Tech Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Gute Verpackungs-ätzendes Soda-Perlen (99%)

Einheitspreis: US $ 420 / Ton
MOQ: 27 Tonnen
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:99%
Klassifikation:Ätznatron
Aussehen:Pearls
Grade Norm:Industrial Grade
Solubleness:Löslichen Alkali
Lonisationsvermögen:Starke Alkali

Soem-Vitamin A Vimtain D Kapsel

Einheitspreis: US $ 0.1 / Stück
MOQ: 380000 Stück

Modell Nr.:1000mg
Funktion:Senkung des Blutdrucks
Bescheinigung:GMP,ISO,HACCPKOSHER
Altersgruppe:Erwachsene
Art:Kapsel
Geschlecht:Unisex

AISI1010 chinesische Kohlenstoffstahl-Kugel der Lieferanten-G100 4.78mm

Einheitspreis: US $ 2.0-3.0 / kg
MOQ: 20 kg
Handelsbedingungen: FOB, CFR, CIF, DAT, FAS, DDP, DAP, CIP, CPT, FCA, EXW

Modell Nr.:4.78mm
Kundenspezifische:Kundenspezifische
Bescheinigung:ISO
Normteile:Ja
Universal:Ja
Art:Ball

Changzhou Feige Steel Ball Co., Ltd.

[Provinz: Jiangsu, China]

Anbieter Lieferant

Automatische Blechdose-Dichtungs-Maschine

Einheitspreis: US $ 3800.0-4000.0 / set
MOQ: 1 set
Handelsbedingungen: FOB, CFR, CIF, DAT, FAS, DDP, DAP, CIP, CPT, FCA, EXW

Modell Nr.:YLG-40
Verpackung:Cans
Automatischer Grad:Automatisch
Verpackungsmaterial:Metall
Anwendung:Kosmetika,Reinigung, Reinigungsmittel,Getränke,Öl,Milchprodukte,Skin Care Produkte,Hair Care Produkte,Gemüse ObstFisch, Fleisch
Verwendung:Outpacking

Zhangjiagang Rachel Machine Co., Ltd.

[Provinz: Jiangsu, China]

Anbieter Lieferant

Pole Mounted Power Transmission/Distribution Transformer Step Down Oil Immersed Type Transformer

Einheitspreis: US $ 50000.0-100000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, FAS, FCA, EXW

Modell Nr.:S(Z)9/S(Z)10/S(Z)11
Anwendung:Power,Elektronisch,InstrumentGleichrichter
Phase:Drei
Ader:Core-Transformator
Kühlungsmethode:Ölbad-Type Transformer
Wicklungstyp:Mehrwicklungstransformator

Ningbo Tianan Group Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Lederindustrie-Chemikalien-Ameisensäure 85% 90% 94%

Einheitspreis: US $ 460 / Ton
MOQ: 1 Ton

Modell Nr.:Tech Grade
Alkyl No.:Gesättigten Säure
Aussehen:Flüssigkeit
Quelle:Hydrolyse
Farbe:Transparent
Warenzeichen:TJXT

Rolle, zum der Multifunktionswärmeübertragung-Drucken-Maschine zu rollen

Einheitspreis: US $ 2580.0-3810.0 / Stück
MOQ: 1 Stück

Modell Nr.:HJD-J9
Art:Siebdruckmaschine
Stil:Screen-Verfahren Printing Press
Farbe & Seite:Multi-Colour Printing Press
Warenzeichen:HJD or Brand Customized
Verpackung:Wooden Case Packing
Brauchen Sie Hilfe?
Kontaktieren Sie bitte uns.
Verwandte Schnellsuche Kategorien
Als eine komplette Sourcing-Plattform aus einer Hand für Verpackungs- & Drucktechnik-Lieferanten, sind wir groß genug, um mit der notwendigen Konstruktionskapazität eine erweiterte Produktlinie von Etiketten und Verpackungen anbieten zu können, zugleich aber klein genug, um eine persönliche Betreuung zu bieten, welche auch heute im Geschäftsleben so überaus wichtig ist. Wir bieten Ihnen nicht nur qualitativ hochwertige Etiketten und Verpackungen sondern wertvolle Lösungen. Technologien entwickeln sich fortlaufend weiter, und so auch unsere Lieferanten, die ihre Standards stets auf hohem Niveau halten und in allen Bereichen Innovationen vorantreiben. Angefangen bei ihren Strategien und Endprodukten bis hin zu Fragen hinsichtlich Umwelterhaltung und Umweltschutz. Wir bieten globalen Einkäufern eine vollständige Ressource für ihren Verpackungsbedarf, wie z. B. Papiertrommel fabrik. Darüberhinaus finden Sie weitere Verpackungs- und Drucklösungen, wie z. B. steeldrum, papier einkaufstasche, bremstrommel zu wettbewerbsfähigen Preisen. Lassen Sie uns Ihnen helfen, unsere wertschöpfenden Produktangebote in Anspruch zu nehmen, um Ihren hohen Heimatmarkt- und Kundenbedürfnissen zu genügen.
Schnellproduktverzeichnis