Startseite » Kunsthandwerk » Andere Freizeitesartikel » Pulver Haustier
Schnellproduktverzeichnis Schnelllieferantenverzeichnis
Seite 136/1045  
Insgesamt 31342 Produkte von etwa 895

Pulver Haustier

Hersteller & Lieferanten
China-Lieferant - Gold-Mitglied Lizenz Verifizierte Lieferant
Sortieren nach: Relevanz
Zeigen: 30 artikel

Maisglutin-Mahlzeit-proteinreiches preiswertes und fein

Einheitspreis: US $ 430.0-450.0 / Ton
MOQ: 20 Tonnen

Modell Nr.:60%
Main Ingredient:Protein
Form:Powder-Feed
Hauptnährstoffe:Functional-Feed
Warenzeichen:deda
Verpackung:25kg or 50 Kg

Wudi Deda Agriculture Co., Limited

[Provinz: Shandong, China]

Anbieter Lieferant

Tiernahrungsmittelfleisch-und -knochen-Mahlzeit

Einheitspreis: US $ 420.0-460.0 / Ton
MOQ: 20 Tonnen

Modell Nr.:50%
Main Ingredient:Protein
Art:Keeping Gesundheit und Wachstum fördern
Form:Powder-Feed
Hauptnährstoffe:Functional-Feed
Warenzeichen:deda

Wudi Deda Agriculture Co., Limited

[Provinz: Shandong, China]

Anbieter Lieferant

Qualität Corn Gluten Meal für Feed Grade (60%75%82%)

Einheitspreis: US $ 290.0-350.0 / Ton
MOQ: 20 Tonnen
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:Nutrition Enhancers
Main Ingredient:Protein
Art:Keeping Gesundheit und Wachstum fördern
Form:Powder-Feed
Hauptnährstoffe:Kraftfutter
Warenzeichen:HY

Getreide, die Beutel, Plastiktasche, seitlicher Gusseted Beutel verpacken

Einheitspreis: US $ 0.01-0.1 / Stück
MOQ: 10000 Stück
Handelsbedingungen: FOB, CIF

Modell Nr.:Side Gusseted Bag
Anwendung:Lebensmittel,Förderung,Haushalt,ChemikalieKleider
Feature:Moisture Proof,Recycelbar,Biologisch abbaubar,Wegwerf-,Shock ResistanceAntistatisch
Material:Schichtwerkstoff
Form:Plastiktaschen
Prozess:Verbundverpackungsbeutel

MST Packaging Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Pp.-PET Doppelt-Schraube granulierender Maschinen-Plastikextruder

Einheitspreis: US $ 59999.0-99999.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB

Modell Nr.:TSE-65
Material verarbeitet:Plastic Bottle
Kunststoff Art:PET
Schraube:Double-Screw
Automatisierung:Automatisierung
Computerized:Computerized

Überschüssige Wiederverwertungs-Granulierer-Pelletisierer-Plastikmaschine

Einheitspreis: US $ 59999.0-99999.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB

Modell Nr.:TSE-75
Rohstoff:PE
Schraube:Double-Screw
Wechselrichter:Wechselrichter
Elektromagnetische Heizung:Elektromagnetische Heizung
Automatisierung:Automatisch

PlastikGranulator Machine für pp.-PET Granules

Einheitspreis: US $ 59999.0-99999.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB

Modell Nr.:TSE-75
Rohstoff:PE
Schraube:Double-Screw
Wechselrichter:Wechselrichter
Elektromagnetische Heizung:Elektromagnetische Heizung
Automatisierung:Automatisch

Plastik, der Maschinerie/überschüssigen PlastikaufbereitenMachine/Plastic Granulierer aufbereitet

Einheitspreis: US $ 59999.0-99999.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB

Modell Nr.:TSE-75
Rohstoff:PE
Schraube:Double-Screw
Wechselrichter:Wechselrichter
Elektromagnetische Heizung:Elektromagnetische Heizung
Automatisierung:Automatisch

EVA/HDPE/LDPE/TPR/AVS Plastiktabletten-Maschinen-Extruder, Farbe Masterbatch Pelletisierer

Einheitspreis: US $ 59999.0-99999.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB

Modell Nr.:TSE-65
Rohstoff:PET
Schraube:Double-Screw
Wechselrichter:Wechselrichter
Elektromagnetische Heizung:Elektromagnetische Heizung
Automatisierung:Automatisch

PET pp. Recycling Extruder Machine, Pellet Making Machine für Sale

Einheitspreis: US $ 59999.0-99999.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB

Modell Nr.:TSE-65
Rohstoff:PP
Schraube:Double-Screw
Wechselrichter:Wechselrichter
Elektromagnetische Heizung:Elektromagnetische Heizung
Automatisierung:Automatisch

Pelletisierer für pp. Plastic Recycling Granulate Machine

Einheitspreis: US $ 59999.0-99999.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB

Modell Nr.:TSE-65
Rohstoff:PVC
Schraube:Double-Screw
Wechselrichter:Wechselrichter
Elektromagnetische Heizung:Elektromagnetische Heizung
Automatisierung:Automatisch

Füller PE+CaCO3 Masterbatch Doppelschraubenzieher-Preis

Einheitspreis: US $ 59999.0-99999.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB

Modell Nr.:TSE-65
Rohstoff:PVC
Schraube:Double-Screw
Wechselrichter:Wechselrichter
Elektromagnetische Heizung:Elektromagnetische Heizung
Automatisierung:Automatisch

Plastik, das granulierende PET Maschine aufbereitet

Einheitspreis: US $ 59999.0-99999.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB

Modell Nr.:TSE-65
Rohstoff:PVC
Schraube:Double-Screw
Wechselrichter:Wechselrichter
Elektromagnetische Heizung:Elektromagnetische Heizung
Automatisierung:Automatisch

PVC, pp., PET beizt zusammensetzende Plastikmaschine

Einheitspreis: US $ 59999.0-99999.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB

Modell Nr.:TSE-65
Rohstoff:PVC
Schraube:Double-Screw
Wechselrichter:Wechselrichter
Elektromagnetische Heizung:Elektromagnetische Heizung
Automatisierung:Automatisch

Vertikales Form Fill Seal Packaging Machine für Frozen Dumpling Jy-520

Einheitspreis: US $ 8300.0-8800.0 / Stück
MOQ: 1 Stück

Modell Nr.:JY-520
Verpackung:Tasche
Automatischer Grad:Automatisch
Verpackungsmaterial:Kunststoff
Verwendung:Innere Verpackung
Art:Verpackung Sealing Machine

Vertikales Form Fill Seal Packaging Machine für Fried Onion Jy-520

Einheitspreis: US $ 8300.0-8800.0 / Stück
MOQ: 1 Stück

Modell Nr.:JY-520
Verpackung:Tasche
Automatischer Grad:Automatisch
Verpackungsmaterial:Kunststoff
Verwendung:Innere Verpackung
Art:Verpackung Sealing Machine

Automatisches Filling Sealing Packing Machine für Detergent Powder Jy-520

Einheitspreis: US $ 8300.0-8800.0 / Stück
MOQ: 1 Stück

Modell Nr.:JY-520
Verpackung:Tasche
Automatischer Grad:Automatisch
Verpackungsmaterial:Kunststoff
Verwendung:Innere Verpackung
Art:Verpackung Sealing Machine

Automatische Macadamia-vertikale Verpackmaschine Jy-520

Einheitspreis: US $ 8300.0-8800.0 / Stück
MOQ: 1 Stück

Modell Nr.:JY-520
Verpackung:Tasche
Automatischer Grad:Automatisch
Verpackungsmaterial:Kunststoff
Verwendung:Innere Verpackung
Art:Verpackung Sealing Machine

Automatisches Vertical Form Fill Seal Packaging Machine für Cereal Jy-520

Einheitspreis: US $ 8300.0-8800.0 / Stück
MOQ: 1 Stück

Modell Nr.:jy-520
Verpackung:Tasche
Automatischer Grad:Automatisch
Verpackungsmaterial:Kunststoff
Verwendung:Innere Verpackung
Art:Verpackung Sealing Machine

Automatisches Vertical Pillow Bag Packing Machine für Confectionery Jy-520

Einheitspreis: US $ 8300.0-8800.0 / Stück
MOQ: 1 Stück

Modell Nr.:JY-520
Verpackung:Tasche
Automatischer Grad:Automatisch
Verpackungsmaterial:Kunststoff
Verwendung:Innere Verpackung
Art:Verpackung Sealing Machine

Doppelte Servobewegungshochgeschwindigkeitsverpackmaschine Jy-520

Einheitspreis: US $ 8300.0-8800.0 / Stück
MOQ: 1 Stück

Modell Nr.:JY-520
Verpackung:Tasche
Automatischer Grad:Automatisch
Verpackungsmaterial:Kunststoff
Verwendung:Innere Verpackung
Art:Verpackung Sealing Machine

Automatische PET Packung-Multifunktionsmaschine Jy-520

Einheitspreis: US $ 8300.0-8800.0 / Stück
MOQ: 1 Stück

Modell Nr.:JY-520
Verpackung:Tasche
Automatischer Grad:Automatisch
Verpackungsmaterial:Kunststoff
Verwendung:Innere Verpackung
Art:Verpackung Sealing Machine

Nahrung Packing und Weighing Machine Jy-420A

Einheitspreis: US $ 19500.0-20000.0 / Stück
MOQ: 1 Stück

Modell Nr.:JY-420A
Verwendung:Verpackung von Waren
Verpackungsmaterial:Kunststoff
Verpackung:Tasche
Driven Type:Elektrisch
Art:Verpackung Produktionslinie

Automatisches Salz, das Verpackungsmaschine Jy-420A wiegt

Einheitspreis: US $ 19500.0-20000.0 / Stück
MOQ: 1 Stück

Modell Nr.:JY-420A
Verwendung:Verpackung von Waren
Verpackungsmaterial:Kunststoff
Verpackung:Tasche
Driven Type:Elektrisch
Art:Verpackung Produktionslinie

Automatisches Weighing Filling und Packing Machine Jy-420A

Einheitspreis: US $ 19500.0-20000.0 / Stück
MOQ: 1 Stück

Modell Nr.:JY-420A
Verwendung:Verpackung von Waren
Verpackungsmaterial:Kunststoff
Verpackung:Tasche
Driven Type:Elektrisch
Art:Verpackung Produktionslinie

Erdnüsse Weighing Filling Sealing Packing Machine mit Fastfood- Bag

Einheitspreis: US $ 19500.0-20000.0 / Stück
MOQ: 1 Stück

Modell Nr.:JY-420A
Verwendung:Verpackung von Waren
Verpackungsmaterial:Kunststoff
Verpackung:Tasche
Driven Type:Elektrisch
Art:Verpackung Produktionslinie

Kombiniert, vertikale Verpackmaschine Jy-420A wiegend

Einheitspreis: US $ 19500.0-20000.0 / Stück
MOQ: 1 Stück

Modell Nr.:JY-420A
Verwendung:Verpackung von Waren
Verpackungsmaterial:Kunststoff
Verpackung:Tasche
Driven Type:Elektrisch
Art:Verpackung Produktionslinie

Cer-anerkannte Teigwaren-Verpacken-Maschinerie Jy-420A

Einheitspreis: US $ 19500.0-20000.0 / Stück
MOQ: 1 Stück

Modell Nr.:JY-420A
Verwendung:Verpackung von Waren
Verpackungsmaterial:Kunststoff
Verpackung:Tasche
Driven Type:Elektrisch
Art:Verpackung Produktionslinie

Automatisches Multi-Kopf Körnchen, das Verpackmaschine Jy-420A wiegt

Einheitspreis: US $ 19500.0-20000.0 / Stück
MOQ: 1 Stück

Modell Nr.:JY-420A
Verwendung:Verpackung von Waren
Verpackungsmaterial:Kunststoff
Verpackung:Tasche
Driven Type:Elektrisch
Art:Verpackung Produktionslinie

Automatisches Körnchen, das füllende Dichtungs-Nahrungsmittelverpackungsmaschine wiegt

Einheitspreis: US $ 19500.0-20000.0 / Stück
MOQ: 1 Stück

Modell Nr.:JY-420A
Verwendung:Verpackung von Waren
Verpackungsmaterial:Kunststoff
Verpackung:Tasche
Driven Type:Elektrisch
Art:Verpackung Produktionslinie
Brauchen Sie Hilfe?
Kontaktieren Sie bitte uns.
Verwandte Produktkategorien
Verwandte Schnellsuche Kategorien
Finden Sie Pulver Haustier fabrik Produkte & Lieferanten, die sich mit dem Kunstgewerbe in China befassen. Wir bieten eine umfangreiche und regelmäßig aktualisierte Datenbank der Kunsthandwerksprodukte, die nahezu all Ihre Beschaffungsanforderungen erfüllt. Da für viele Menschen der Alltag meist eintönig und farblos ist, wünschen wir uns in vielen Fällen etwas Anderes, Einzigartiges oder Besonderes, um unseren Geist zu inspirieren oder unsere Vorlieben auszudrücken. Deshalb müssen wir eine vollendete Sammlung ausgewählter Kunst, handgefertigter Kunstwerke, Dekorationen & Ornamente im Allgemeinen haben, die voll mit Leben, Leidenschaft und Esprit ist. Von handwerklichen Erzeugnissen zu Bastelbedarf, wir haben wonach Sie suchen. Insbesondere steht hier eine Online-Datenbank zu Pulver Haustier fabrik zur Verfügung, wo wir denken, dass sie Ihre Einkaufsplanung beflügeln könnte. Kaufen Sie Künstlerbedarf en gros zu unglaublichen Preisen, einschließlich (aber nicht beschränkt auf) haustier waren, verpackung haustier, pulver maschine. Wir garantieren, dass Sie mit dem hochwertigen Einkäuferservice und den wettbewerbsfähigen Kunstprodukten, die Sie von Made-in-China.com beziehen können, zufrieden sein werden.
Schnellproduktverzeichnis