Startseite » Kunsthandwerk » Andere Freizeitesartikel » Pulver Haustier
Schnellproduktverzeichnis Schnelllieferantenverzeichnis
Seite 29/1083  
Insgesamt 32465 Produkte von etwa 1909

Pulver Haustier

Hersteller & Lieferanten
China-Lieferant - Gold-Mitglied
Sortieren nach: Relevanz
Zeigen: 30 artikel

Haustier-super dünnes Funkeln-Puder der Oberseiten-10

Einheitspreis: US $ 8.25 / kg
MOQ: 1 kg
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:AS3404
Warenzeichen:Silver Rabbit
Verpackung:25kgs Bags or Carton
Standard:SGS and OTHERS
Herkunft:Anhui China
HS-Code:39269090

Multi Farben Enconomic Stapel-flexographische Drucken-Maschine

Einheitspreis: US $ 9000.0-43000.0 / Set
MOQ: 1 Set

Modell Nr.:YT Series
Drucken Page:Doppelseitigen
Prägestruktur:Rotary Letterpress
Struktur:Gestapelte
Automatischer Grad:Automatisch
Druckgeschwindigkeit:90m / min

Active plus reinigendes Puder

Einheitspreis: US $ 280.0-600.0 / Ton
MOQ: 10 Tonnen

Duft:floral Scent
Altersgruppe:Erwachsene
Bilden:Power
Warenzeichen:OEM BRAND
Verpackung:15g-1000kg
Standard:ISO9001: 2000, REACH

Topseller Chemicals Company Limited

[Provinz: Shandong, China]

Anbieter Lieferant

Aluminiumüberzug-Film für das heiße Lamellieren

Einheitspreis: US $ 3.4-10.0 / Ton
MOQ: 3 Tonnen

Modell Nr.:24mic
Verwendung:Dekorfolie
Art:Metallisierten Film
Material:PET
Härte:Weich
Transparenz:Undurchsichtig

Guangdong EKO Film Manufacture Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Kleiner Verpackungs-hoher Schaumgummi-gutes Preis-Wäscherei-Reinigungsmittel-Waschpulver für ...

Einheitspreis: US $ 350.0-700.0 / Ton
MOQ: 1 Ton

Modell Nr.:CH-0196
Bilden:Power
Warenzeichen:OEM
Verpackung:30g/Bag, 150bags/Carton
Standard:ISO, BV, SGS
Herkunft:Fujian

12mm Gletscher-weißes Acrylblatt festes OberflächenCorian

Einheitspreis: US $ 45.0-280.0 / Stück
MOQ: 30 Stück
Handelsbedingungen: FOB, CIF, EXW

Modell Nr.:KKR-Acrylic Solid Surface
Art:Solid Surface
Oberflächenfinish:Matt
Farbe:Beige
Form:Big Slab
Kantenbearbeitung:Wohnung

Helle Sojasoßen-japanische Sojasoße

Einheitspreis: US $ 10.0-100.0 / Box
MOQ: 1 Box

Modell Nr.:A1503-01
Art:Brewage SeasoningAugenblick
Geschmack:Salzig
Verpackung:Flasche
Warenzeichen:TASSYA
Verpackung:Box, Carton

Kiefernholz-Katze-Sänfte des Katze König-Add Active Carbon

Einheitspreis: US $ 524.6 / containers
MOQ: 1 containers
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:HA-MS-SMHXT01
Art:Pet Cleaning Products
Cleaning Products Type:WC Produkte
Anwendung:Katze
Operationstyp:Handbuch
Größe:Klein

Hochwertiger sich hin- und herbewegender Fisch-Zufuhr-Produktionszweig/sich hin- und herbewegende ...

Einheitspreis: US $ 300000.0-500000.0 / Stück
MOQ: 1 Stück

Modell Nr.:WF
Art:Pellet Mill
Verarbeitungsobjekt:Getreide
Verarbeitung Technics:Crushing-before-Mixing
Siebgewebe:Mit Siebgewebe
Zerkleinerungsgeräte Typ:Feed-Hammermühle

Liyang Weifeng Equipment Co., Ltd.

[Provinz: Jiangsu, China]

Anbieter Lieferant

Geflügel führen Gerätenhundenahrungsmittelmaschine

Einheitspreis: US $ 50000 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, EXW, CIF

Modell Nr.:DSE85
Art:Pellet Mill
Verarbeitungsobjekt:Animal-Derived-Feed
Verarbeitung Technics:Mixing-before-Zerkleinerung
Siebgewebe:Mit Siebgewebe
Zerkleinerungsgeräte Typ:Feed-Hammermühle

Jinan Dingrun Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

Reibender PuderPulverizer Belüftung-Miller

Einheitspreis: US $ 5000.0-13000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:PNMP
Automatisierung:Automatisch
Computerized:Non-Computerized
Bescheinigung:CE,ISO9001: 2008,SGSUL
Warenzeichen:WANROOETECH
Verpackung:Standard Export Packing

Wanrooe Machinery Co., Ltd.

[Provinz: Jiangsu, China]

Anbieter Lieferant

Fenster-Profil und Tür-Profil-Koextrusion-Maschinerie

Einheitspreis: US $ 40000.0-50000.0 / Stück
MOQ: 1 Stück

Modell Nr.:ZYSJZJ
Art:Profil Extruder
Plastic Verarbeitete:PVC
Produkttyp:Profil Extrusionsformmaschine
Feeding-Modus:Ein-Feed
Assembly Structure:Integral-Extruder

Qingdao Zhuoya Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

Qualitäts-Regenbogen-Funkeln-Puder mit niedrigem Preis

Modell Nr.:LB205
Warenzeichen:xucai
Verpackung:1kg/OPP, 10kg/Cutton, 15kg/Cotton
Standard:1/8"~1/128"
Herkunft:Dongguan, Guangdong, China
HS-Code:3926909090

Dongguan Xucai Arts & Crafts Co., Ltd

[Provinz: Guangdong, China]

Doppeltes seitliches heißes Schmelzunterseiten-Gewebe-Band für Stickerei

Einheitspreis: US $ 0.6-1.3 / Square Meter
MOQ: 600 Quadratmeter

Modell Nr.:DTHY10
Adhäsivität:Doppelseitiges Klebeband
Bewerben Umgebungstemperatur:Hochtemperatur-Klebeband
Warenzeichen:Broadya
Verpackung:Standard Package
Standard:1040mm(usable 1020mm)*1000m

Fhqr Serien-Hochgeschwindigkeitsplastikfilm-aufschlitzende Maschine

Einheitspreis: US $ 15000.0-28000.0 / Stück
MOQ: 1 Stück

Modell Nr.:FHQR-1300
Anwendung:Mechinery & Hardware
Art:Breitband-Schneidemaschine
Arbeitsmethode:Round Messer Cutting
Struktur:Schneidteil
Verpackung:Film

Ruian Newsun Machinery Factory

[Provinz: Zhejiang, China]

Anbieter Lieferant

Hoting, welches die Haustier-Plastikflasche aufbereitet Extruder-Maschine verkauft

Einheitspreis: US $ 28000.0-100000.0 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF, CIP

Modell Nr.:TSE-75
Produkttyp:Granulierextruder
Feeding-Modus:Ein-Feed
Assembly Structure:Separate Nextruder
Schraube:Twin-Screw
Engagement-System:Vollineinander

FDA-gebilligter Kaffee-Beutel mit Ventil-und Seiten-Stützblech

Einheitspreis: US $ 0.08-0.13 / Stück
MOQ: 20000 Stück

Modell Nr.:450g
Anwendung:Lebensmittel,Förderung,Haushalt,ChemikalieKleider
Feature:Moisture Proof,Recycelbar,Biologisch abbaubar,Wegwerf-Shock Resistance
Material:Schichtwerkstoff
Prozess:Verbundverpackungsbeutel
Bag Variety:Orgel-Tasche

Silver Dragon Industrial Limited

[Provinz: Guangdong, China]

Anbieter Lieferant

Kettenmesser-Laminat-Maschine Lfm-Z108L für Film des Haustier-BOPP

Einheitspreis: US $ 65000.0-70000.0 / Stück
MOQ: 1 Stück

Modell Nr.:LFM-Z108L
Driven Type:Pneumatisch
Klassifikation:Pre-Coating Laminiermaschine
Anwendung:Packaging Paper,Filmmaterial,Color PrintingSoft Vorstand
Automatischer Grad:Automatisch
Membranmaterial:Matt Film

Huada Printing Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

Dxd-40f automatische Kaffee-Verpackungsmaschine

Einheitspreis: US $ 1.0-10000.0 / Stück
MOQ: 1 Stück

Modell Nr.:DXD-40F
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care ProdukteÖl
Art:Und Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Füllung

Nahrungsmittelbeutel Selfheat Drucken, das flache Unterseiten-Packpapier-Beutel packt

Einheitspreis: US $ 0.01-0.8 / Stück
MOQ: 10000 Stück

Modell Nr.:JC-F003
Kundenspezifische:Kundenspezifische
Gewicht:0,5-1 kg
Papiertyp:Packpapier
Verwendung:EssenGesundheitspflege-Produkte
Form:Platz

12mm nahtlose Verbindung strukturierter MarmoracrylCorian fester Lageplan

Einheitspreis: US $ 59.7-128.7 / Stück
MOQ: 30 Stück
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:KKR-solid surface
Art:Solid Surface
Oberflächenfinish:Matt
Farbe:Grün
Form:Big Slab
Kantenbearbeitung:Wohnung

KKR Stone Baths Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Oberseite 10 Pet Glitter Powder für Party

Einheitspreis: US $ 8.25 / kg
MOQ: 1 kg
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:AS3404
Warenzeichen:Silver Rabbit
Verpackung:25kgs Bags or Carton
Standard:SGS and OTHERS
Herkunft:Anhui China
HS-Code:39269090

Nahrung für Haustiere, die Maschinen-Geflügel Tierviehbestand-Fisch-Zufuhr-Tausendstel bildet

Einheitspreis: US $ 1600.0-2800.0 / Stück
MOQ: 1 Stück

Modell Nr.:DGP-60 pet food making machine
Art:Pellet Mill
Verarbeitungsobjekt:Mixed-Feed
Verarbeitung Technics:Crushing-before-Mixing
Siebgewebe:Ohne Siebgewebe
Zerkleinerungsgeräte Typ:Feed-Hammermühle

Super7 Reinigungsmittel-Waschpulver für Wäscherei

Einheitspreis: US $ 280.0-600.0 / Ton
MOQ: 10 Tonnen

Duft:floral Scent
Altersgruppe:Erwachsene
Bilden:Power
Warenzeichen:OEM BRAND
Verpackung:15g-1000kg
Standard:ISO9001: 2000, REACH

Topseller Chemicals Company Limited

[Provinz: Shandong, China]

Anbieter Lieferant

Aluminiumhaustier-lamellierender Film des Splitter-24mic

Einheitspreis: US $ 3.4-10.0 / Ton
MOQ: 3 Tonnen

Modell Nr.:24mic
Verwendung:Dekorfolie
Art:Metallisierten Film
Material:PET
Härte:Weich
Transparenz:Undurchsichtig

Guangdong EKO Film Manufacture Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Dauerhaftes Geruch-Wäscherei-Waschpulver (250g, 500g, 750g, 1.1kg, 2.5kg, 3kg)

Einheitspreis: US $ 350.0-700.0 / Ton
MOQ: 1 Ton

Modell Nr.:CH-0197
Bilden:Power
Warenzeichen:OEM
Verpackung:250g, 500g, 750g, 1.1kg, 2.5kg, 3kg
Standard:ISO, BV, SGS
Herkunft:Fujian

Helle Sojasoße für das japanische Art-Kochen

Einheitspreis: US $ 10.0-100.0 / Box
MOQ: 1 Box

Modell Nr.:A1503-01
Art:Brewage SeasoningAugenblick
Geschmack:Salzig
Verpackung:Flasche
Warenzeichen:TASSYA
Verpackung:Box, Carton

Hoffnung-Strecke-Kugel, die niedrige Staub-Bentonit-Katze-Sänfte aufhäuft

Einheitspreis: US $ 177.42 / containers
MOQ: 2 containers
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:HA-MS-FH02
Art:Pet Cleaning Products
Cleaning Products Type:WC Produkte
Anwendung:Katze
Operationstyp:Handbuch
Größe:Klein

Forschungs-Peptide Triptorelin/Gnrh --In USA Frankreich /Australia einlagern

Einheitspreis: US $ 2.0-6.0 / vials
MOQ: 10 vials

Modell Nr.:Triptorelin/ GnRH
Pulver:Ja
Kundenspezifische:Kundenspezifische
Bescheinigung:GMP
Bundesland:Solide
Reinheit:> 98%

Reine weiße Corian feste acrylsaueroberfläche

Einheitspreis: US $ 32.0-110.24 / Stück
MOQ: 30 Stück
Handelsbedingungen: FOB, CIF, EXW

Modell Nr.:corian solid surface
Art:Solid Surface
Oberflächenfinish:Matt
Form:Big Slab
Kantenbearbeitung:Wohnung
Bescheinigung:SGS
Brauchen Sie Hilfe?
Kontaktieren Sie bitte uns.
Verwandte Produktkategorien
Verwandte Schnellsuche Kategorien
Finden Sie Pulver Haustier fabrik Produkte & Lieferanten, die sich mit dem Kunstgewerbe in China befassen. Wir bieten eine umfangreiche und regelmäßig aktualisierte Datenbank der Kunsthandwerksprodukte, die nahezu all Ihre Beschaffungsanforderungen erfüllt. Da für viele Menschen der Alltag meist eintönig und farblos ist, wünschen wir uns in vielen Fällen etwas Anderes, Einzigartiges oder Besonderes, um unseren Geist zu inspirieren oder unsere Vorlieben auszudrücken. Deshalb müssen wir eine vollendete Sammlung ausgewählter Kunst, handgefertigter Kunstwerke, Dekorationen & Ornamente im Allgemeinen haben, die voll mit Leben, Leidenschaft und Esprit ist. Von handwerklichen Erzeugnissen zu Bastelbedarf, wir haben wonach Sie suchen. Insbesondere steht hier eine Online-Datenbank zu Pulver Haustier fabrik zur Verfügung, wo wir denken, dass sie Ihre Einkaufsplanung beflügeln könnte. Kaufen Sie Künstlerbedarf en gros zu unglaublichen Preisen, einschließlich (aber nicht beschränkt auf) haustier waren, verpackung haustier, pulver maschine. Wir garantieren, dass Sie mit dem hochwertigen Einkäuferservice und den wettbewerbsfähigen Kunstprodukten, die Sie von Made-in-China.com beziehen können, zufrieden sein werden.
Schnellproduktverzeichnis