Startseite » Kunsthandwerk » Andere Freizeitesartikel » Pulver Haustier
Schnellproduktverzeichnis Schnelllieferantenverzeichnis
Seite 29/1121  
Insgesamt 33605 Produkte von etwa 1680

Pulver Haustier

Hersteller & Lieferanten
China-Lieferant - Gold-Mitglied
Sortieren nach: Relevanz
Zeigen: 30 artikel

Qualitäts-Regenbogen-Funkeln-Puder mit niedrigem Preis

Modell Nr.:LB205
Warenzeichen:xucai
Verpackung:1kg/OPP, 10kg/Cutton, 15kg/Cotton
Standard:1/8"~1/128"
Herkunft:Dongguan, Guangdong, China
HS-Code:3926909090

Dongguan Xucai Arts & Crafts Co., Ltd

[Provinz: Guangdong, China]

Hoting, welches die Haustier-Plastikflasche aufbereitet Extruder-Maschine verkauft

Einheitspreis: US $ 28000.0-100000.0 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF, CIP

Modell Nr.:TSE-75
Produkttyp:Granulierextruder
Feeding-Modus:Ein-Feed
Assembly Structure:Separate Nextruder
Schraube:Twin-Screw
Engagement-System:Vollineinander

Taiwan-Haustier-Funkeln-Puder der Oberseiten-10

Einheitspreis: US $ 8.25 / kg
MOQ: 1 kg
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:AS3204-AS3906
Warenzeichen:Silver Rabbit
Verpackung:25kgs Bags or Carton
Standard:SGS and OTHERS
Herkunft:Anhui China
HS-Code:39269090

Hochwertiger Kaffee-Beutel mit Gleichheit für Kaffee-Puder-Verpackung

Einheitspreis: US $ 0.08-0.13 / Stück
MOQ: 20000 Stück

Modell Nr.:250g
Anwendung:Lebensmittel,Förderung,Haushalt,ChemikalieKleider
Feature:Moisture Proof,Recycelbar,Biologisch abbaubar,Wegwerf-Shock Resistance
Material:Schichtwerkstoff
Prozess:Verbundverpackungsbeutel
Bag Variety:Orgel-Tasche

Silver Dragon Industrial Limited

[Provinz: Guangdong, China]

Anbieter Lieferant

Super7 Reinigungsmittel-Waschpulver für Wäscherei

Einheitspreis: US $ 280.0-600.0 / Ton
MOQ: 10 Tonnen

Duft:floral Scent
Altersgruppe:Erwachsene
Bilden:Power
Warenzeichen:OEM BRAND
Verpackung:15g-1000kg
Standard:ISO9001: 2000, REACH

Topseller Chemicals Company Limited

[Provinz: Shandong, China]

Anbieter Lieferant

Milch-Maschine für pasteurisierte Milch und H-Milch

Einheitspreis: US $ 43000.0-45000.0 / Set
MOQ: 1 Set

Modell Nr.:GT
Verarbeiten:Thermal Processing
Energiequelle:Elektro
Bescheinigung:CEISO 9001
Automatischer Grad:Automatische
Anwendung:MilchJoghurt

Shanghai Genyond Technology Co., Ltd.

[Provinz: Shanghai, China]

Anbieter Lieferant

Neuer Zustands-sich hin- und herbewegende Fisch-Zufuhr-Tablette, die Maschine herstellt

Einheitspreis: US $ 2700 / Set
MOQ: 1 Set

Modell Nr.:DGP60-C
Art:Pellet Mill
Verarbeitung Technics:Crushing-before-Mixing
Siebgewebe:Mit Siebgewebe
Zerkleinerungsgeräte Typ:Feed-Hammermühle
Pellet Mill Typ:Flache Düse Granulator

Fischnahrungsmittelmaschinenfischzufuhr, die Maschine herstellt

Einheitspreis: US $ 40000 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, EXW, CIF

Modell Nr.:DSE85
Energiequelle:Elektro
Verarbeiten:Mild Verarbeitung
Automatischer Grad:Automatische
Anwendung:Hund,Fisch,KatzeVogel
Einzugstyp:Fischmehl

Jinan Dingrun Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

Superwäscherei der reinigungs-3.3kg, die reinigendes Puder für das Entfernen des Flecks wäscht

Einheitspreis: US $ 350.0-700.0 / Ton
MOQ: 1 Ton

Modell Nr.:CH-0299
Bilden:Power
Warenzeichen:OEM
Verpackung:3.3kg/Box, 4PCS/Carton
Standard:ISO, BV, SGS
Herkunft:China

Haustier-Plastikrollenfilm (YD75mic)

Einheitspreis: US $ 2400.0-2600.0 / Ton
MOQ: 1 Ton

Modell Nr.:YD-75mic
Transparenz:Transparent
Layered:Basisstufe
Härte:Weich
Heat Seal:EVA
Warenzeichen:FSEKO

Guangdong EKO Film Manufacture Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

40ml farbige Aluminiumschrauben-Gläser für das kosmetische Sahneverpacken

Einheitspreis: US $ 0.1-0.13 / Set
MOQ: 5000 Sets

Modell Nr.:G5038-40
Kundenspezifische:Kundenspezifische
Umweltfreundlich:Umweltfreundlich
Bescheinigung:SGSISO
Verwendung:LebensmittelChemikalie
Material:Kunststoff

Guangzhou Sharelemon Packaging Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Epinephelinae schwarze Karpfen-Geflügel-Verarbeitungsanlage-Maschinerie

Einheitspreis: US $ 2700.0-28000.0 / Stück
MOQ: 1 Stück

Modell Nr.:ASTDGP-90
Art:Pellet Mill
Verarbeitungsobjekt:Mixed-Feed
Verarbeitung Technics:Crushing-before-Mixing
Siebgewebe:Mit Siebgewebe
Zerkleinerungsgeräte Typ:Feed-Hammermühle

Forschungs-Peptide Triptorelin/Gnrh --In USA Frankreich /Australia einlagern

Einheitspreis: US $ 2.0-6.0 / vials
MOQ: 10 vials

Modell Nr.:Triptorelin/ GnRH
Pulver:Ja
Kundenspezifische:Kundenspezifische
Bescheinigung:GMP
Bundesland:Solide
Reinheit:> 98%

Mit hohem Ausschuss Plastikzeile Doppelschraubenzieher der pelletisierung-Tse-135

Einheitspreis: US $ 180000.0-250000.0 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:TSE-135
Schraube:Double-Screw
Automatisierung:Automatisierung
Computerized:Computerized
Bescheinigung:UL,SGS,ISO9001: 2008CE
Warenzeichen:Haisi

Haustier USA-Funkeln-Puder der Oberseiten-10

Einheitspreis: US $ 8.25 / kg
MOQ: 1 kg
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:AS3204-AS3906
Warenzeichen:Silver Rabbit
Verpackung:25kgs Bags or Carton
Standard:SGS and OTHERS
Herkunft:Anhui China
HS-Code:39269090

Automatisches Wasser-Plastikcup-flüssige Plombe und Dichtungs-Maschine

Einheitspreis: US $ 10000.0-30000.0 / Stück
MOQ: 1 Stück

Modell Nr.:CF-12
Art:Volumetrische Füllmaschine
Automatischer Grad:Vollautomatische
Medientyp:Flüssigkeit
Füllventil Leiter:Muti-Head
Feed-Zylinderstruktur:Einzel-Zimmer Feeding

Mittlerer Dichtungs-Kaffee-Verpackungs-Beutel mit seitlichem Stützblech

Einheitspreis: US $ 0.08-0.13 / Stück
MOQ: 20000 Stück

Modell Nr.:450g
Anwendung:Lebensmittel,Förderung,Haushalt,ChemikalieKleider
Feature:Moisture Proof,Recycelbar,Biologisch abbaubar,Wegwerf-Shock Resistance
Material:Schichtwerkstoff
Prozess:Verbundverpackungsbeutel
Bag Variety:Orgel-Tasche

Silver Dragon Industrial Limited

[Provinz: Guangdong, China]

Anbieter Lieferant

Helle Sojasoße für japanische Sushi-Nahrungsmittel

Einheitspreis: US $ 10.0-100.0 / Box
MOQ: 1 Box

Modell Nr.:A0501-03
Art:Brewage SeasoningAugenblick
Geschmack:Salzig
Verpackung:Flasche
Warenzeichen:TASSYA
Verpackung:Box, Carton

Lager-faltendes Haustier formt Maschendraht-Behälter vor

Einheitspreis: US $ 40.0-60.0 / Stück
MOQ: 50 Stück
Handelsbedingungen: FOB, CFR, EXW, CIF

Modell Nr.:HML-W28
Art:Metall Lagerung Cage
Gefaltet:Gefaltete
Maschenweite:50mm × 100mm
Drahtdurchmesser:5mm
Füße Höhe:100mm

Kaut neues China-Haustier des Entwurfs-2016 Hersteller-Maschinerie

Einheitspreis: US $ 10000.0-30000.0 / Set
MOQ: 1 Set

Modell Nr.:KLD- pet chews maker machinery
Energiequelle:Elektro
Automatischer Grad:Automatische
Anwendung:Hund
Einzugstyp:Fleisch-und Knochenmehl
Kundenspezifische:Kundenspezifische

Jinan Kelid Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

Reine weiße feste acrylsaueroberfläche

Einheitspreis: US $ 32.0-110.24 / Stück
MOQ: 30 Stück
Handelsbedingungen: FOB, CIF, EXW

Modell Nr.:solid surface
Art:Solid Surface
Oberflächenfinish:Matt
Form:Big Slab
Kantenbearbeitung:Wohnung
Bescheinigung:SGS

Handwäsche-reinigendes Seifen-Puder

Einheitspreis: US $ 300.0-800.0 / Ton
MOQ: 10 Tonnen
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:tsl9282
Form:Pulver
Verwendung:Für Stoff Waschen & Tending
Geschmack:Blumen Flavor
Art:Gewöhnlich
Spec:1-3kg

Topseller Chemicals Company Limited

[Provinz: Shandong, China]

Anbieter Lieferant

Geflügel führen Gerätenhundenahrungsmittelmaschine

Einheitspreis: US $ 50000 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, EXW, CIF

Modell Nr.:DSE85
Art:Pellet Mill
Verarbeitungsobjekt:Animal-Derived-Feed
Verarbeitung Technics:Mixing-before-Zerkleinerung
Siebgewebe:Mit Siebgewebe
Zerkleinerungsgeräte Typ:Feed-Hammermühle

Jinan Dingrun Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

Verkaufsschlager-konkurrenzfähiger Preis-Goldlieferanten-Wäscherei-Puder-reinigendes Waschpulver

Einheitspreis: US $ 350.0-700.0 / Ton
MOQ: 1 Ton

Modell Nr.:CH-0322
Bilden:Power
Warenzeichen:OEM
Verpackung:Carton or Woven Bag
Standard:30g to 500kg
Herkunft:Fujian

3D BOPP Thermal Laminating Film für Anti-Fake Label

Einheitspreis: US $ 0.34-1.0 / Ton
MOQ: 3 Tonnen

Modell Nr.:BH-5
Verwendung:Dekorfolie
Anwendung:Gebrauchsgutverpacken
Art:Holographischen Film
Material:BOPP
Verarbeitungsart:Mehrere Extrusion

Guangdong EKO Film Manufacture Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Fhqr Serien-Hochgeschwindigkeitsplastikfilm-aufschlitzende Maschine

Einheitspreis: US $ 15000.0-28000.0 / Stück
MOQ: 1 Stück

Modell Nr.:FHQR-1300
Anwendung:Mechinery & Hardware
Art:Breitband-Schneidemaschine
Arbeitsmethode:Round Messer Cutting
Struktur:Schneidteil
Verpackung:Film

Ruian Newsun Machinery Factory

[Provinz: Zhejiang, China]

Anbieter Lieferant

Brachsen 800-900kg/H Parabramis Pekinensis Wels-Zufuhr-Pelletisierer

Einheitspreis: US $ 2700.0-28000.0 / Stück
MOQ: 1 Stück

Modell Nr.:ASTDGP-120
Art:Pellet Mill
Verarbeitungsobjekt:Mixed-Feed
Verarbeitung Technics:Crushing-before-Mixing
Siebgewebe:Mit Siebgewebe
Zerkleinerungsgeräte Typ:Feed-Hammermühle

Kundenspezifisches buntes Drucken-Metallfirmenzeichen-weiche Decklack-Hundeplakette

Einheitspreis: US $ 0.35-0.45 / Stück
MOQ: 300 Stück
Handelsbedingungen: FOB, EXW

Modell Nr.:JP-Dog Tag18
Verwendung:Werbegeschenke,Flaschenöffner,Münzhalter,Photo Frame,Taschenlampe,Urlaub,Beobachten,UhrKompass
Stil:Niedlich
Form:Tiere
Passend für:Universal-
Verarbeitung:Offsetdruck

Zhongshan B&S Hardware Gift Factory

[Provinz: Guangdong, China]

Anbieter Lieferant

Gute Qualitätshochgeschwindigkeitsmischer-Extruder-Maschine

Einheitspreis: US $ 2000.0-5000.0 / Set
MOQ: 1 Set
Handelsbedingungen: FOB

Modell Nr.:SHR
Mischer Typ:Powder Mixer
Arbeits:High Speed ​​Mixer
Rühren Type:Spirale
Anwendung:Flüssigkeit mit Feststoff,Pulver,FlüssigkeitGranulat
Bescheinigung:CE,ISOUL

Haustier-Amerika-Funkeln-Puder der Oberseiten-10

Einheitspreis: US $ 8.25 / kg
MOQ: 1 kg
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:AS3204-AS3906
Warenzeichen:Silver Rabbit
Verpackung:25kgs Bags or Carton
Standard:SGS and OTHERS
Herkunft:Anhui China
HS-Code:39269090
Brauchen Sie Hilfe?
Kontaktieren Sie bitte uns.
Verwandte Produktkategorien
Verwandte Schnellsuche Kategorien
Finden Sie Pulver Haustier fabrik Produkte & Lieferanten, die sich mit dem Kunstgewerbe in China befassen. Wir bieten eine umfangreiche und regelmäßig aktualisierte Datenbank der Kunsthandwerksprodukte, die nahezu all Ihre Beschaffungsanforderungen erfüllt. Da für viele Menschen der Alltag meist eintönig und farblos ist, wünschen wir uns in vielen Fällen etwas Anderes, Einzigartiges oder Besonderes, um unseren Geist zu inspirieren oder unsere Vorlieben auszudrücken. Deshalb müssen wir eine vollendete Sammlung ausgewählter Kunst, handgefertigter Kunstwerke, Dekorationen & Ornamente im Allgemeinen haben, die voll mit Leben, Leidenschaft und Esprit ist. Von handwerklichen Erzeugnissen zu Bastelbedarf, wir haben wonach Sie suchen. Insbesondere steht hier eine Online-Datenbank zu Pulver Haustier fabrik zur Verfügung, wo wir denken, dass sie Ihre Einkaufsplanung beflügeln könnte. Kaufen Sie Künstlerbedarf en gros zu unglaublichen Preisen, einschließlich (aber nicht beschränkt auf) haustier waren, verpackung haustier, pulver maschine. Wir garantieren, dass Sie mit dem hochwertigen Einkäuferservice und den wettbewerbsfähigen Kunstprodukten, die Sie von Made-in-China.com beziehen können, zufrieden sein werden.
Schnellproduktverzeichnis