Startseite » Kunsthandwerk » Andere Freizeitesartikel » Pulver Haustier
Schnellproduktverzeichnis Schnelllieferantenverzeichnis
Seite 88/1078  
Insgesamt 32325 Produkte von etwa 873

Pulver Haustier

Hersteller & Lieferanten
China-Lieferant - Gold-Mitglied
Sortieren nach: Relevanz
Zeigen: 30 artikel

Fhqj Serien-Hochgeschwindigkeitsplastikfilm-aufschlitzende Maschine

Einheitspreis: US $ 22000.0-38000.0 / Stück
MOQ: 1 Stück

Modell Nr.:FHQJ-1300
Art:Breitband-Schneidemaschine
Arbeitsmethode:Round Messer Cutting
Struktur:Schneidteil
Verpackung:Film
Anwendbares Verfahren:Prozessmaterialien

Ruian Newsun Machinery Factory

[Provinz: Zhejiang, China]

Anbieter Lieferant

Hochgeschwindigkeits-BOPP Film-aufschlitzende Maschine der Fhqj Serien-

Einheitspreis: US $ 22000.0-38000.0 / Stück
MOQ: 1 Stück

Modell Nr.:FHQJ-1300
Art:Breitband-Schneidemaschine
Arbeitsmethode:Round Messer Cutting
Struktur:Schneidteil
Verpackung:Film
Anwendbares Verfahren:Prozessmaterialien

Ruian Newsun Machinery Factory

[Provinz: Zhejiang, China]

Anbieter Lieferant

Fhqj Serie Hochgeschwindigkeits-PET Film-aufschlitzende Maschine

Einheitspreis: US $ 22000.0-38000.0 / Stück
MOQ: 1 Stück

Modell Nr.:FHQJ-1300
Art:Breitband-Schneidemaschine
Arbeitsmethode:Round Messer Cutting
Struktur:Schneidteil
Verpackung:Film
Anwendbares Verfahren:Prozessmaterialien

Ruian Newsun Machinery Factory

[Provinz: Zhejiang, China]

Anbieter Lieferant

Fhqj Serien-Hochgeschwindigkeitshaustier-Film-aufschlitzende Maschine

Einheitspreis: US $ 22000.0-38000.0 / Stück
MOQ: 1 Stück

Modell Nr.:FHQJ-1300
Art:Breitband-Schneidemaschine
Arbeitsmethode:Round Messer Cutting
Struktur:Schneidteil
Verpackung:Film
Anwendbares Verfahren:Prozessmaterialien

Ruian Newsun Machinery Factory

[Provinz: Zhejiang, China]

Anbieter Lieferant

Fhqj Serie Hochgeschwindigkeits-Belüftung-Film-aufschlitzende Maschine

Einheitspreis: US $ 22000.0-38000.0 / Stück
MOQ: 1 Stück

Modell Nr.:FHQJ-1300
Art:Breitband-Schneidemaschine
Arbeitsmethode:Round Messer Cutting
Struktur:Schneidteil
Verpackung:Film
Anwendbares Verfahren:Prozessmaterialien

Ruian Newsun Machinery Factory

[Provinz: Zhejiang, China]

Anbieter Lieferant

Hochgeschwindigkeits-CPP Film-aufschlitzende Maschine der Fhqj Serien-

Einheitspreis: US $ 22000.0-38000.0 / Stück
MOQ: 1 Stück

Modell Nr.:FHQJ-1300
Art:Breitband-Schneidemaschine
Arbeitsmethode:Round Messer Cutting
Struktur:Schneidteil
Verpackung:Film
Anwendbares Verfahren:Prozessmaterialien

Ruian Newsun Machinery Factory

[Provinz: Zhejiang, China]

Anbieter Lieferant

Fhqj Serien-Hochgeschwindigkeitsplastikfilm-Ausschnitt-Maschine

Einheitspreis: US $ 22000.0-38000.0 / Stück
MOQ: 1 Stück

Modell Nr.:FHQJ-1300
Art:Breitband-Schneidemaschine
Arbeitsmethode:Round Messer Cutting
Struktur:Schneidteil
Verpackung:Film
Anwendbares Verfahren:Prozessmaterialien

Ruian Newsun Machinery Factory

[Provinz: Zhejiang, China]

Anbieter Lieferant

Fhqj Serien-Hochgeschwindigkeitsplastikfilm-Slitter

Einheitspreis: US $ 22000.0-38000.0 / Stück
MOQ: 1 Stück

Modell Nr.:FHQJ-1300
Art:Breitband-Schneidemaschine
Arbeitsmethode:Round Messer Cutting
Struktur:Schneidteil
Verpackung:Film
Anwendbares Verfahren:Prozessmaterialien

Ruian Newsun Machinery Factory

[Provinz: Zhejiang, China]

Anbieter Lieferant

Hochgeschwindigkeits-BOPP Film-Slitter der Fhqj Serien-

Einheitspreis: US $ 22000.0-38000.0 / Stück
MOQ: 1 Stück

Modell Nr.:FHQJ-1300
Art:Breitband-Schneidemaschine
Arbeitsmethode:Round Messer Cutting
Struktur:Schneidteil
Verpackung:Film
Anwendbares Verfahren:Prozessmaterialien

Ruian Newsun Machinery Factory

[Provinz: Zhejiang, China]

Anbieter Lieferant

Hochgeschwindigkeits-OPP Film-Slitter der Fhqj Serien-

Einheitspreis: US $ 22000.0-38000.0 / Stück
MOQ: 1 Stück

Modell Nr.:FHQJ-1300
Art:Breitband-Schneidemaschine
Arbeitsmethode:Round Messer Cutting
Struktur:Schneidteil
Verpackung:Film
Anwendbares Verfahren:Prozessmaterialien

Ruian Newsun Machinery Factory

[Provinz: Zhejiang, China]

Anbieter Lieferant

Hochgeschwindigkeits-CPP Film-Slitter der Fhqj Serien-

Einheitspreis: US $ 22000.0-38000.0 / Stück
MOQ: 1 Stück

Modell Nr.:FHQJ-1300
Art:Breitband-Schneidemaschine
Arbeitsmethode:Round Messer Cutting
Struktur:Schneidteil
Verpackung:Film
Anwendbares Verfahren:Prozessmaterialien

Ruian Newsun Machinery Factory

[Provinz: Zhejiang, China]

Anbieter Lieferant

Fhqj Serie Hochgeschwindigkeits-PET Film-Slitter

Einheitspreis: US $ 22000.0-38000.0 / Stück
MOQ: 1 Stück

Modell Nr.:FHQJ-1300
Art:Breitband-Schneidemaschine
Arbeitsmethode:Round Messer Cutting
Struktur:Schneidteil
Verpackung:Film
Anwendbares Verfahren:Prozessmaterialien

Ruian Newsun Machinery Factory

[Provinz: Zhejiang, China]

Anbieter Lieferant

Fhqj Serien-Hochgeschwindigkeitshaustier-Film-Slitter

Einheitspreis: US $ 22000.0-38000.0 / Stück
MOQ: 1 Stück

Modell Nr.:FHQJ-1300
Art:Breitband-Schneidemaschine
Arbeitsmethode:Round Messer Cutting
Struktur:Schneidteil
Verpackung:Film
Anwendbares Verfahren:Prozessmaterialien

Ruian Newsun Machinery Factory

[Provinz: Zhejiang, China]

Anbieter Lieferant

Fhqj Serie Hochgeschwindigkeits-Belüftung-Film-Slitter

Einheitspreis: US $ 22000.0-38000.0 / Stück
MOQ: 1 Stück

Modell Nr.:FHQJ-1300
Art:Breitband-Schneidemaschine
Arbeitsmethode:Round Messer Cutting
Struktur:Schneidteil
Verpackung:Film
Anwendbares Verfahren:Prozessmaterialien

Ruian Newsun Machinery Factory

[Provinz: Zhejiang, China]

Anbieter Lieferant

Fhqj Serien-Hochgeschwindigkeitsplastikfilm, der Maschinerie aufschlitzt

Einheitspreis: US $ 22000.0-38000.0 / Stück
MOQ: 1 Stück

Modell Nr.:FHQJ-1300
Art:Breitband-Schneidemaschine
Arbeitsmethode:Round Messer Cutting
Struktur:Schneidteil
Verpackung:Film
Anwendbares Verfahren:Prozessmaterialien

Ruian Newsun Machinery Factory

[Provinz: Zhejiang, China]

Anbieter Lieferant

Hochgeschwindigkeits-BOPP Film der Fhqj Serien-, dermaschinerie aufschlitzt

Einheitspreis: US $ 22000.0-38000.0 / Stück
MOQ: 1 Stück

Modell Nr.:FHQJ-1300
Art:Breitband-Schneidemaschine
Arbeitsmethode:Round Messer Cutting
Struktur:Schneidteil
Verpackung:Film
Anwendbares Verfahren:Prozessmaterialien

Ruian Newsun Machinery Factory

[Provinz: Zhejiang, China]

Anbieter Lieferant

Hochgeschwindigkeits-OPP Film der Fhqj Serien-, dermaschinerie aufschlitzt

Einheitspreis: US $ 22000.0-38000.0 / Stück
MOQ: 1 Stück

Modell Nr.:FHQJ-1300
Art:Breitband-Schneidemaschine
Arbeitsmethode:Round Messer Cutting
Struktur:Schneidteil
Verpackung:Film
Anwendbares Verfahren:Prozessmaterialien

Ruian Newsun Machinery Factory

[Provinz: Zhejiang, China]

Anbieter Lieferant

Fhqj Serie Hochgeschwindigkeits-PET Film, der Maschinerie aufschlitzt

Einheitspreis: US $ 22000.0-38000.0 / Stück
MOQ: 1 Stück

Modell Nr.:FHQJ-1300
Art:Breitband-Schneidemaschine
Arbeitsmethode:Round Messer Cutting
Struktur:Schneidteil
Verpackung:Film
Anwendbares Verfahren:Prozessmaterialien

Ruian Newsun Machinery Factory

[Provinz: Zhejiang, China]

Anbieter Lieferant

Fhqj Serien-Hochgeschwindigkeitshaustier-Film, der Maschinerie aufschlitzt

Einheitspreis: US $ 22000.0-38000.0 / Stück
MOQ: 1 Stück

Modell Nr.:FHQJ-1300
Art:Breitband-Schneidemaschine
Arbeitsmethode:Round Messer Cutting
Struktur:Schneidteil
Verpackung:Film
Anwendbares Verfahren:Prozessmaterialien

Ruian Newsun Machinery Factory

[Provinz: Zhejiang, China]

Anbieter Lieferant

Fhqj Serie Hochgeschwindigkeits-Belüftung-Film, der Maschinerie aufschlitzt

Einheitspreis: US $ 22000.0-38000.0 / Stück
MOQ: 1 Stück

Modell Nr.:FHQJ-1300
Art:Breitband-Schneidemaschine
Arbeitsmethode:Round Messer Cutting
Struktur:Schneidteil
Verpackung:Film
Anwendbares Verfahren:Prozessmaterialien

Ruian Newsun Machinery Factory

[Provinz: Zhejiang, China]

Anbieter Lieferant

Hochgeschwindigkeits-CPP Film der Fhqj Serien-, dermaschinerie aufschlitzt

Einheitspreis: US $ 22000.0-38000.0 / Stück
MOQ: 1 Stück

Modell Nr.:FHQJ-1300
Art:Breitband-Schneidemaschine
Arbeitsmethode:Round Messer Cutting
Struktur:Schneidteil
Verpackung:Film
Anwendbares Verfahren:Prozessmaterialien

Ruian Newsun Machinery Factory

[Provinz: Zhejiang, China]

Anbieter Lieferant

Fhqj Serien-Hochgeschwindigkeitspapier, das Maschinerie aufschlitzt

Einheitspreis: US $ 22000.0-38000.0 / Stück
MOQ: 1 Stück

Modell Nr.:FHQJ-1300
Art:Breitband-Schneidemaschine
Arbeitsmethode:Round Messer Cutting
Struktur:Schneidteil
Verpackung:Film
Anwendbares Verfahren:Prozessmaterialien

Ruian Newsun Machinery Factory

[Provinz: Zhejiang, China]

Anbieter Lieferant

Fhqj Serien-Hochgeschwindigkeitsaluminiumfolie, die Maschinerie aufschlitzt

Einheitspreis: US $ 22000.0-38000.0 / Stück
MOQ: 1 Stück

Modell Nr.:FHQJ-1300
Art:Breitband-Schneidemaschine
Arbeitsmethode:Round Messer Cutting
Struktur:Schneidteil
Verpackung:Film
Anwendbares Verfahren:Prozessmaterialien

Ruian Newsun Machinery Factory

[Provinz: Zhejiang, China]

Anbieter Lieferant

Fhqj Serien-Hochgeschwindigkeitsaluminiumfolie-aufschlitzende Maschine

Einheitspreis: US $ 22000.0-38000.0 / Stück
MOQ: 1 Stück

Modell Nr.:FHQJ-1300
Art:Breitband-Schneidemaschine
Arbeitsmethode:Round Messer Cutting
Struktur:Schneidteil
Verpackung:Film
Anwendbares Verfahren:Prozessmaterialien

Ruian Newsun Machinery Factory

[Provinz: Zhejiang, China]

Anbieter Lieferant

Fhqj Serien-Hochgeschwindigkeitsaufschlitzende Papiermaschine

Einheitspreis: US $ 22000.0-38000.0 / Stück
MOQ: 1 Stück

Modell Nr.:FHQJ-1300
Art:Breitband-Schneidemaschine
Arbeitsmethode:Round Messer Cutting
Struktur:Schneidteil
Verpackung:Film
Anwendbares Verfahren:Prozessmaterialien

Ruian Newsun Machinery Factory

[Provinz: Zhejiang, China]

Anbieter Lieferant

Qfj Serien-horizontale Computer-Steueraufschlitzende Selbstmaschine

Einheitspreis: US $ 5000.0-15000.0 / Stück
MOQ: 1 Stück

Modell Nr.:QFJ-700/1100/1300
Arbeitsmethode:Round Messer Cutting
Struktur:Schneidteil
Verpackung:Film
Anwendbares Verfahren:Prozessmaterialien
Geeignete Untergründe:Filmschneide

Ruian Newsun Machinery Factory

[Provinz: Zhejiang, China]

Anbieter Lieferant

Qfj Serien-horizontale Computer-Steuerselbstplastikfilm-aufschlitzende Maschine

Einheitspreis: US $ 5000.0-15000.0 / Stück
MOQ: 1 Stück

Modell Nr.:QFJ-700/1100/1300
Arbeitsmethode:Round Messer Cutting
Struktur:Schneidteil
Verpackung:Film
Anwendbares Verfahren:Prozessmaterialien
Geeignete Untergründe:Filmschneide

Ruian Newsun Machinery Factory

[Provinz: Zhejiang, China]

Anbieter Lieferant

Fleisch-Knochen-Mahlzeit-Treffen rein

Einheitspreis: US $ 420.0-460.0 / Ton
MOQ: 20 Tonnen

Modell Nr.:50%
Main Ingredient:Protein
Art:Keeping Gesundheit und Wachstum fördern
Form:Powder-Feed
Hauptnährstoffe:Functional-Feed
Warenzeichen:deda

Wudi Deda Agriculture Co., Limited

[Provinz: Shandong, China]

Anbieter Lieferant

PVC-Deckenverkleidung, die Maschinerie herstellt

Einheitspreis: US $ 1000.0-45000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, FCA, EXW

Modell Nr.:Xinxing
Art:Blatt Extruder
Produkttyp:Strangpressmaschine
Feeding-Modus:Multiple-Feed
Assembly Structure:Integral-Extruder
Schraube:Twin-Screw

CER einzelner Diplomschraubenzieher

Einheitspreis: US $ 1000.0-45000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DAT, FAS, DDP, DAP, CIP, CPT, FCA, EXW

Modell Nr.:Xinxing
Art:Blatt Extruder
Produkttyp:Strangpressmaschine
Feeding-Modus:Multiple-Feed
Assembly Structure:Integral-Extruder
Schraube:Twin-Screw
Brauchen Sie Hilfe?
Kontaktieren Sie bitte uns.
Verwandte Produktkategorien
Verwandte Schnellsuche Kategorien
Finden Sie Pulver Haustier fabrik Produkte & Lieferanten, die sich mit dem Kunstgewerbe in China befassen. Wir bieten eine umfangreiche und regelmäßig aktualisierte Datenbank der Kunsthandwerksprodukte, die nahezu all Ihre Beschaffungsanforderungen erfüllt. Da für viele Menschen der Alltag meist eintönig und farblos ist, wünschen wir uns in vielen Fällen etwas Anderes, Einzigartiges oder Besonderes, um unseren Geist zu inspirieren oder unsere Vorlieben auszudrücken. Deshalb müssen wir eine vollendete Sammlung ausgewählter Kunst, handgefertigter Kunstwerke, Dekorationen & Ornamente im Allgemeinen haben, die voll mit Leben, Leidenschaft und Esprit ist. Von handwerklichen Erzeugnissen zu Bastelbedarf, wir haben wonach Sie suchen. Insbesondere steht hier eine Online-Datenbank zu Pulver Haustier fabrik zur Verfügung, wo wir denken, dass sie Ihre Einkaufsplanung beflügeln könnte. Kaufen Sie Künstlerbedarf en gros zu unglaublichen Preisen, einschließlich (aber nicht beschränkt auf) haustier waren, verpackung haustier, pulver maschine. Wir garantieren, dass Sie mit dem hochwertigen Einkäuferservice und den wettbewerbsfähigen Kunstprodukten, die Sie von Made-in-China.com beziehen können, zufrieden sein werden.
Schnellproduktverzeichnis