Startseite » Verpackung und Druck » Mutifunktionäre Verpackungsmaschine » Teebeutel
Schnellproduktverzeichnis Schnelllieferantenverzeichnis
Seite 1/2261  
Insgesamt 67826 Produkte von etwa 4239

Teebeutel

Hersteller & Lieferanten
China-Lieferant - Gold-Mitglied
Sortieren nach: Relevanz
Zeigen: 30 artikel

Fastfood- Kunststoffgehäuse-Beutel für Imbiß, Nahrung, Tee, Kaffee

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 0.01-0.05 / Stück
MOQ: 20000 Stück
Handelsbedingungen: FOB, CFR, CIF, CIP, EXW

Modell Nr.:MD-Z-08
Anwendung:Lebensmittel,Förderung,Haushalt,ChemikalieKleider
Feature:Moisture Proof,Recycelbar,Wegwerf-,Shock ResistanceAntistatisch
Material:Schichtwerkstoff
Form:Plastiktaschen
Prozess:Plastic Packaging Taschen

Automatische weiche Abschminktuch-Papier-Verpackungsmaschine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 100.0-30000.0 / Set
MOQ: 1 Set

Modell Nr.:TP-A100
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Qingdao Top Packing Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Form-Ineinander greifen-kreative künstliche Ring-Kristallschmucksachen

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 1.09-1.2 / Stück
MOQ: 36 Stück

Modell Nr.:R1828
Material:Legierung
Art:Cocktail-Ring
Geschlecht:Weiblich
Herstellungsverarbeitung:Überzug
Form:Quadrat

Shenzhen Sunrising Trade Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Runder Großhandelszoll gedrucktes Nickerchen machendes Microfiber Mandala-Badetuch

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 4.38-6.63 / Stück
MOQ: 500 Stück

Modell Nr.:JS-20186
Verwendung:Zuhause,Hotel,GeschenkeSport
Feature:Quick Dry Handtuch
Altersgruppe:Erwachsene
Gram Gewicht:500-7000GSM
Stil:Ebene

Toiletten-Seidenpapier-Verpackungs-Maschinerie-Wärmeshrink-Dichtungs-Maschine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 10.0-30000.0 / Set
MOQ: 1 Set

Modell Nr.:TPM900/210
Verwendung:Verpackung von WarenProduzieren Packband
Verpackungsmaterial:Kunststoff
Verpackung:Tasche
Driven Type:Elektrisch
Art:Verpackung Produktionslinie

Qingdao Top Packing Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Automatische Beutel-Verpackungsmaschine für Körnchen, Imbiß

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 2600.0-31000.0 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF, DAT, FAS, DDP, DAP, CIP, CPT, FCA, EXW

Modell Nr.:VFC200G/250G/350G/400G
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Tianjin Newidea Machinery Co., Ltd.

[Provinz: Tianjin, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Saubere Energie-hölzernes Sägemehl-Tabletten-Tausendstel

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 9600.0-59000.0 / Stück
MOQ: 1 Stück

Modell Nr.:560
Automatischer Grad:Halbautomatisch
Controlling-Modus:Künstlich
Energie Sparen:Energy Saving
Bescheinigung:ISO
Garantie:1 Jahr

Shandong Kingoro Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Meistgekaufte moderne Hauptwohnzimmer-Möbel (Cx7001)

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 1944 / Set
MOQ: 5 Sets

Modell Nr.:CX7001
Stil:Moderne
Material:Stoff
Gefaltet:Entfaltete
Kundenspezifische:Nicht Customized
Zustand:Neu

Pistazie, Zucker, Apple schneidet Verpackungsmaschine (VFFS)

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 3500.0-10000.0 / Stück
MOQ: 1 Stück

Modell Nr.:MD-K420
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Und Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

China SME Group Co., Ltd.

[Provinz: Shanghai, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Automatische Verpackungsmaschine für Dörrobst, Imbiß, Körnchen, Chips

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 2600.0-23000.0 / Set
MOQ: 1 Set

Modell Nr.:VFC200EW
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Tianjin Newidea Machinery Co., Ltd.

[Provinz: Tianjin, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Automatische Qualitäts-MultispurVerpackungsmaschine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 16000.0-35000.0 / Set
MOQ: 1 Set

Modell Nr.:IP-ML500/4LG
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Automatisches Korn, das füllende Dichtungs-Nahrungsmittelverpackungsmaschine (2016, wiegt neu)

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 20000.0-50000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CIF

Modell Nr.:RZ6/8-200/300A
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Und Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:FüllungDichtung

Ruian Unionpack International Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

2g Deoxidizer Nahrungsmittelgrad-Sauerstoff-Reiniger für Muttern, Mooncakes langfristige Lagerung

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 0.007-0.009 / Stück
MOQ: 5000 Stück

Modell Nr.:30002-SJ-TP
Form:Beads
Trocknungsverfahren:Statische Trocknung
Art:Montmorillonit Trockenmittel
Trockenmittel:Physikalische Trockenmittel
Warenzeichen:Topcod/OEM

Foshan Shunde Topcod Industry Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Automatische DrehHochgeschwindigkeitsverpackmaschine für Puder-Flüssigkeit-Körnchen

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 30000.0-40000.0 / Set
MOQ: 1 Set

Modell Nr.:MR8-200RH
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Getränke,Milchprodukte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Und Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:FüllungDichtung

Hangzhou Merry Sino Technology Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Automatische Flüssigkeit, die füllende Dichtungs-Nahrungsmittelverpackungsmaschine für ...

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 20000.0-50000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CIF

Modell Nr.:RZ6/8-200/300A
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Und Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:FüllungDichtung

Ruian Unionpack International Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Gelbwurz-Puder-Paprika-Puder-Kraut-Puder-Protein-Puder-Kaffee-Puder-reinigende ...

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 16000.0-22000.0 / Set
MOQ: 1 Set

Modell Nr.:HTL-420F
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Tee,Gemüse Obst,Snack,ReismehlGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Ruian Honetop Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Vollautomatischer Imbiß, Muttern, Körnchen, Nahrungsmittelquetschkissen-Beutel, der die füllende ...

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 6500.0-48000.0 / Sets
MOQ: 1 Sets

Modell Nr.:RL420
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Tee,Gemüse Obst,Snack,ReismehlGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Packpapier-Reißverschluss-Kaffee-Kunststoffgehäuse-Beutel

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 0.3-0.5 / Stück
MOQ: 10000 Stück
Handelsbedingungen: FOB, CIF

Modell Nr.:Stand up Pouch
Anwendung:Lebensmittel,Förderung,Haushalt,ChemikalieKleider
Feature:Moisture ProofRecycelbar
Material:Schichtwerkstoff
Form:Plastiktaschen
Prozess:Plastic Packaging Taschen

JIANGMEN MST PACKAGING GROUP LIMITED

[Provinz: Guangdong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Automatische Kräuterteebeutel-Verpacken-Maschinerie (Modell DXDCH-10D)

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 16500.0-16800.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:DXDCH-10D
Automatischer Grad:Automatisch
Art:Und Verschließmaschine
Bildungsfunktion:Bildung,FüllungDichtung
Driven Type:Elektrisch
Warenzeichen:Hondon

Vollautomatischer Stadt-Abfall, der Maschine zur Energie aufbereitet

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 300000.0-500000.0 / set
MOQ: 1 set

Modell Nr.:FDY
Zertifizierung:SGS,CEISO9001
Bedingung:Neu
Anwendung:Autoteil,Erz,Tee,Fleisch,Aquatic Produkt,GemüseKorn
Warenzeichen:Qunfeng
Verpackung:Wrapped Film

Automatischer festes Material-Imbiss-Biskuit-Verpackmaschinen

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 6900.0-18000.0 / Stück
MOQ: 1 Stück

Modell Nr.:LY-420
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Und Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:FüllungDichtung

Foshan Hong Fill Machinery Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Städtisches Feststoff-Management, das den Systems-städtischen Abfall sortiert Gerät sortiert

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 300000.0-500000.0 / set
MOQ: 1 set

Modell Nr.:FDY
Zertifizierung:SGS,CEISO9001
Bedingung:Neu
Anwendung:Autoteil,Erz,Tee,Fleisch,Aquatic Produkt,GemüseKorn
Warenzeichen:Qunfeng
Verpackung:Wrapped Film

Salz-Kaffee Snus Gewürz-Imbiss-Popcorn-Nahrungsmittelquetschkissen-Puder-automatischer ...

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 1980 / Stück
MOQ: 1 Stück

Modell Nr.:BT-320
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Öl,Tee,Snack,ReismehlGewürz
Art:Und Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Golden Machinery Equipment Co., Ltd.

[Provinz: Henan, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Bohnen-Soße-Fruchtsaft-reinigende ...

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 35000.0-42000.0 / Set
MOQ: 1 Set

Modell Nr.:HT-8Y/H
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Und Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:FüllungDichtung

Ruian Honetop Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Neues Design 80PCS Barrel Packing Baby Wipes

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 0.68 / plastic barrel
MOQ: 15000 plastic barrel
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:SW514
Verwendung:Reinigung,Skin Care,Antiseptisch,Mosquito Repelling,Anti-SweatKühlung
Material:Non-Woven
Alkohol:Alkoholfrei
Warenzeichen:Jiayan
Verpackung:Plastic Canister. Barrel or Box

Zhejiang Jiayan Daily Commodity Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

CER anerkannte automatische Hochgeschwindigkeitseiscreme-Verpackmaschine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 3800.0-4500.0 / Stück
MOQ: 1 Stück

Modell Nr.:BG-250BD
Automatischer Grad:Automatisch
Anwendung:Kosmetika,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Und Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Foshan Bogal Packing Machinery Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Shrink-Verpackung/Verpackmaschine

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 15000.0-100000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:SFR
Anwendung:Lebensmittel,Ware,Machinery & Hardware,Textil-,Alkohol und Tabak,Spielzeug,Chemikalie,Kleider,Geschenke & Arts,Speise-Medizinisch
Automatischer Grad:Automatisch
Driven Typ:Elektrisch
Art und Weise der Verpackung:Vierseitendichtungstyp
Stellen Sie Schnell:Frequenzkonversion Speed ​​Regulation

China-Fabrik-Preis-voll automatische Verpackungssystem-Maschine für Verpackungs-Chips, Süßigkeit, ...

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 22000.0-35000.0 / Set
MOQ: 1 Set

Modell Nr.:IP-SL500
Automatischer Grad:Automatisch
Anwendung:Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Wegwerfplastikcup-Fachmann-Lieferant

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 0.025-0.03 / Stück
MOQ: 50000 Stück
Handelsbedingungen: FOB

Modell Nr.:Customized According To Your Requirement
Kapazität:16 Unzen
Wegwerf-:Wegwerf-
Kunststoff Art:PP
Stil:Einfach
Phantasie:Gedruckt

Guangzhou Jianxin Plastic Products Factory

[Provinz: Guangdong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Fastfood- Packpapier-Beutel mit Reißverschluss

Ausgewählte Produkt des China-Lieferant

Einheitspreis: US $ 0.02-0.9 / Stück
MOQ: 10000 Stück

Modell Nr.:ZB-010
Anwendung:Lebensmittel,FörderungChemikalie
Feature:Moisture Proof,Recycelbar,Biologisch abbaubarWegwerf-
Material:Papier
Form:Straight Tube Bag
Prozess:Verbundverpackungsbeutel

Qingdao Zhongbang Packaging Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com
1-10 11-20 21-30 31-40 41-50 ...
Brauchen Sie Hilfe?
Kontaktieren Sie bitte uns.
Verwandte Schnellsuche Kategorien
Als eine komplette Sourcing-Plattform aus einer Hand für Verpackungs- & Drucktechnik-Lieferanten, sind wir groß genug, um mit der notwendigen Konstruktionskapazität eine erweiterte Produktlinie von Etiketten und Verpackungen anbieten zu können, zugleich aber klein genug, um eine persönliche Betreuung zu bieten, welche auch heute im Geschäftsleben so überaus wichtig ist. Wir bieten Ihnen nicht nur qualitativ hochwertige Etiketten und Verpackungen sondern wertvolle Lösungen. Technologien entwickeln sich fortlaufend weiter, und so auch unsere Lieferanten, die ihre Standards stets auf hohem Niveau halten und in allen Bereichen Innovationen vorantreiben. Angefangen bei ihren Strategien und Endprodukten bis hin zu Fragen hinsichtlich Umwelterhaltung und Umweltschutz. Wir bieten globalen Einkäufern eine vollständige Ressource für ihren Verpackungsbedarf, wie z. B. Teebeutel fabrik. Darüberhinaus finden Sie weitere Verpackungs- und Drucklösungen, wie z. B. tee, geschenk-verpackungsbeutel, pvc plastiktüte zu wettbewerbsfähigen Preisen. Lassen Sie uns Ihnen helfen, unsere wertschöpfenden Produktangebote in Anspruch zu nehmen, um Ihren hohen Heimatmarkt- und Kundenbedürfnissen zu genügen.
Schnellproduktverzeichnis