Startseite » Koffer, Handtaschen und Geschenkkisten » Ranzen » Säcke verwendet
Schnellproduktverzeichnis Schnelllieferantenverzeichnis
Seite 1422/17012  
Insgesamt 510342 Produkte von etwa 15948

Säcke verwendet

Hersteller & Lieferanten
China-Lieferant - Gold-Mitglied
Sortieren nach: Relevanz
Zeigen: 30 artikel

Automatische multi Weg-Verpacken-Maschinerie (NF-700)

Einheitspreis: US $ 40000.0-70000.0 / Stück
MOQ: 1 SET
Handelsbedingungen: FOB, CFR, CIF, FAS, DDP, CIP, CPT, FCA, EXW

Modell Nr.:NF-700
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,KosmetikaGetränke
Art:Und Verschließmaschine
Enden Spezies:Bag Moulding
Driven Type:Mechanisch

Tianjin Newidea Machinery Co., Ltd.

[Provinz: Tianjin, China]

Anbieter Lieferant

Automatische Teebeutel-Hochgeschwindigkeitsverpackmaschine

Einheitspreis: US $ 22000 / Stück
MOQ: 1 1 set
Handelsbedingungen: FOB, CFR, CIF, DAT, FAS, DDP, DAP, CIP, CPT, FCA, EXW

Modell Nr.:ND-C8I
Automatischer Grad:Automatisch
Anwendung:Reinigung, ReinigungsmittelKosmetika
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Driven Type:Mechanisch

Tianjin Newidea Machinery Co., Ltd.

[Provinz: Tianjin, China]

Anbieter Lieferant

Volles automatisches Teebeutel-Verpackungsmaschine-Selbstverpacken ND-C8IV/C15

Einheitspreis: US $ 41000 / Stück
MOQ: 1 SET
Handelsbedingungen: FOB, CFR, CIF, DAT, FAS, DDP, DAP, CIP, CPT, FCA, EXW

Modell Nr.:ND-C8IV/C15
Automatischer Grad:Automatisch
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Driven Type:Elektrisch
Warenzeichen:NEWPACK

Tianjin Newidea Machinery Co., Ltd.

[Provinz: Tianjin, China]

Anbieter Lieferant

Metallgelegentliche Verpackung für Aufsatz

Einheitspreis: US $ 1500 / cubic meter
MOQ: 1 cubic meter
Handelsbedingungen: FOB, CFR, CIF, DDP, EXW

Modell Nr.:BHHTTL
Zustand:Neu
Bescheinigung:SGSISO 9001
Standard:GB
Kundenspezifische:Kundenspezifische
Material:Metall

Metallbienenwabe-Substratfläche-Katalysator für Automobil/Motorrad (Eurov-Emissionstandards)

Einheitspreis: US $ 1.7-9.0 / Stück
MOQ: 10 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, EXW

Modell Nr.:BHHTMHC006
Körper-Material:Stahl
Entlastung Norm:Euro V
Zertifizierung:ISO9001TS16949
Warenzeichen:BHLJ
Verpackung:Carton+Pallet

Katalysator-rundes Bienenwabe-Metallsubstrat katalytisch

Einheitspreis: US $ 1.7-9.0 / Stück
MOQ: 10 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, EXW

Modell Nr.:BHHTMHC006
Körper-Material:Stahl
Entlastung Norm:Euro V
Zertifizierung:ISO9001TS16949
Warenzeichen:BHLJ
Verpackung:Carton+Pallet

Metall Honeycomb Substrate für Vehicle/Motorcycle Catalytic Converters

Einheitspreis: US $ 1.7-9.0 / Stück
MOQ: 10 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, EXW

Modell Nr.:BHHTMHC006
Körper-Material:Stahl
Entlastung Norm:Euro V
Zertifizierung:ISO9001TS16949
Warenzeichen:BHLJ
Verpackung:Carton+Pallet

Qualitäts-keramische Kugeln (Si3n4/Sic/Zro2/Al2O3)

Einheitspreis: US $ 170.0-1000.0 / Ton
MOQ: 1 Ton

Modell Nr.:GXLJ-BB
Kundenspezifische:Kundenspezifische
Bescheinigung:ISO
Normteile:Ja
Universal:Ja
Warenzeichen:BHHT

Fabrikmäßig hergestellter CNC, der Ersatzteile maschinell bearbeitet

Einheitspreis: US $ 10.0-25.0 / Stück
MOQ: 1 Stück

Modell Nr.:Spare Parts
Standard:GB,ENChina GB-Code
Stoff:Rostfreier Stahl
Verpackung:Wooden Case, Master Carton
Standard:OEM
Herkunft:China

Borui Precision Technology Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Kundenspezifischer schneller Prototyp für Haushaltsgerät-Plastikdeckel

Einheitspreis: US $ 25.0-250.0 / Stück
MOQ: 1 Stück

Modell Nr.:OEM
Oberflächenbehandlung:Sprühfarbe
Verpackung:Wooden Carton
Standard:cnc prototyping service
Herkunft:China
Produktionskapazität:30000

Borui Precision Technology Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Yogatraining Eignung-Gymnastik-Geräten-Schaumgummi-Rollen-Gymnastik-Schaumgummi-Rolle

Einheitspreis: US $ 11.88-12.08 / Set
MOQ: 300 Sets

Modell Nr.:ZV-KITS0006
Mattenmaterial:TPE
Mat Dicke:≥ 6mm
Mat Dimension:61cmx183cm
Yoga Kugeldurchmesser:26 "
Farbe:Abbildung

Ningbo Zhongchen Plastic Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

VerpackenSuppiler Fastfood- Beutel mit Tülle

Einheitspreis: US $ 0.02-0.04 / Stück
MOQ: 50000 Stück

Modell Nr.:D0092
Anwendung:Lebensmittel
Feature:Moisture Proof
Material:Schichtwerkstoff
Form:Plastiktaschen
Prozess:Plastic Packaging Taschen

Guangdong Danqing Printing Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Yingcai 1m Breiten-rotes Steinmuster-hydrografischer Film

Einheitspreis: US $ 1.6-2.5 / Square Meter
MOQ: 20 Quadratmeter

Bescheinigung:SGS
Art:Wassertransferdruck
Anwendung:Getränk,Medical Box,Leder,Cosmetic Box,TextilienKleidung
Warenzeichen:Yingcai
Verpackung:Hard Paper Tube
Standard:1m width

Yingcai 1m Breiten-Goldmarmor flüssiger Imag Druck

Einheitspreis: US $ 1.6-2.5 / Square Meter
MOQ: 20 Quadratmeter

Bescheinigung:SGS
Art:Wassertransferdruck
Anwendung:Getränk,Medical Box,Leder,Cosmetic Box,TextilienKleidung
Warenzeichen:Yingcai
Verpackung:Hard Paper Tube
Standard:1m width

Yingcai 1m Breitebrown-flüssiges Marmorierungbild-hydrografischer Film

Einheitspreis: US $ 1.6-2.5 / Square Meter
MOQ: 20 Quadratmeter

Bescheinigung:SGS
Art:Wassertransferdruck
Anwendung:Getränk,Medical Box,Leder,Cosmetic Box,TextilienKleidung
Warenzeichen:Yingcai
Verpackung:Hard Paper Tube
Standard:1m width

Yingcai 1m Breiten-Schwarz-Ader-Marmor-Übergangsdruck-Film

Einheitspreis: US $ 1.6-2.5 / Square Meter
MOQ: 20 Quadratmeter

Bescheinigung:SGS
Art:Wassertransferdruck
Anwendung:Getränk,Medical Box,Leder,Cosmetic Box,TextilienKleidung
Warenzeichen:Yingcai
Verpackung:Hard Paper Tube
Standard:1m width

Yingcai 1m Breiten-Stein-Muster-moosiger Eichen-Wasser-Übergangsfilm

Einheitspreis: US $ 1.6-2.5 / Square Meter
MOQ: 20 Quadratmeter

Bescheinigung:SGS
Art:Wassertransferdruck
Anwendung:Getränk,Medical Box,Leder,Cosmetic Box,TextilienKleidung
Warenzeichen:Yingcai
Verpackung:Hard Paper Tube
Standard:1m width

Yingcai 1m Breiten-malvenfarbener bedruckbarer Wasser-Übergangsmarmorierungfilm

Einheitspreis: US $ 1.6-2.5 / Square Meter
MOQ: 20 Quadratmeter

Bescheinigung:SGS
Art:Wassertransferdruck
Anwendung:Getränk,Medical Box,Leder,Cosmetic Box,TextilienKleidung
Warenzeichen:Yingcai
Verpackung:Hard Paper Tube
Standard:1m width

Yingcai 1m Breiten-grauer Marmorübergangsdruck-Film

Einheitspreis: US $ 1.6-2.5 / Square Meter
MOQ: 20 Quadratmeter

Bescheinigung:SGS
Art:Wassertransferdruck
Anwendung:Getränk,Medical Box,Leder,Cosmetic Box,TextilienKleidung
Warenzeichen:Yingcai
Verpackung:Hard Paper Tube
Standard:1m width

CNC gedrehte kupferne Präzisionsteile

Einheitspreis: US $ 2.5-25.0 / Stück
MOQ: 1 Stück

Modell Nr.:OEM
Standard:GB,ENChina GB-Code
Stoff:Rostfreier Stahl
Verpackung:Wooden Case, Master Carton
Standard:OEM
Herkunft:China

Borui Precision Technology Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Cnc-Prototyp für Plastikform

Einheitspreis: US $ 25.0-250.0 / Stück
MOQ: 1 Stück

Modell Nr.:OEM
Oberflächenbehandlung:Sprühfarbe
Verpackung:Wooden Carton
Standard:cnc prototyping service
Herkunft:China
Produktionskapazität:30000

Borui Precision Technology Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Kundenspezifisches CNC-Präzisions-Ausrüstungs-Plastikteil

Einheitspreis: US $ 70.0-85.0 / Stück
MOQ: 1 Stück

Modell Nr.:OEM
Standard:GBChina GB-Code
Oberflächenbehandlung:Sprühfarbe
Verpackung:Wooden Carton
Standard:cnc prototyping service
Herkunft:China

Borui Precision Technology Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

Yingcai 1m Breiten-Goldmarmor-hydrografischer Film

Einheitspreis: US $ 1.6-2.5 / Square Meter
MOQ: 20 Quadratmeter

Bescheinigung:SGS
Art:Wassertransferdruck
Anwendung:Getränk,Medical Box,Leder,Cosmetic Box,TextilienKleidung
Warenzeichen:Yingcai
Verpackung:Hard Paper Tube
Standard:1m width

Yingcai 1m Breiten-Marmor-Muster-wasserlösliche Filme

Einheitspreis: US $ 1.6-2.5 / Square Meter
MOQ: 20 Quadratmeter

Bescheinigung:SGS
Art:Wassertransferdruck
Anwendung:Getränk,Medical Box,Leder,Cosmetic Box,TextilienKleidung
Warenzeichen:Yingcai
Verpackung:Hard Paper Tube
Standard:1m width

Yingcai 1m breit grüner Marmorgroßhandelswasser-Übergangsdrucken-Film

Einheitspreis: US $ 1.6-2.5 / Square Meter
MOQ: 20 Quadratmeter

Bescheinigung:SGS
Art:Wassertransferdruck
Anwendung:Getränk,Medical Box,Leder,Cosmetic Box,TextilienKleidung
Warenzeichen:Yingcai
Verpackung:Hard Paper Tube
Standard:1m width

Yingcai 1m gelbes Goldmarmor-flüssiger Druck-Film

Einheitspreis: US $ 1.6-2.5 / Square Meter
MOQ: 20 Quadratmeter

Bescheinigung:SGS
Art:Wassertransferdruck
Anwendung:Getränk,Medical Box,Leder,Cosmetic Box,TextilienKleidung
Warenzeichen:Yingcai
Verpackung:Hard Paper Tube
Standard:1m width

Yingcai 1m breiter Marmortintenstrahl-Drucken-Film des entwurfs-PVA

Einheitspreis: US $ 1.6-2.5 / Square Meter
MOQ: 20 Quadratmeter

Bescheinigung:SGS
Art:Wassertransferdruck
Anwendung:Getränk,Medical Box,Leder,Cosmetic Box,TextilienKleidung
Warenzeichen:Yingcai
Verpackung:Hard Paper Tube
Standard:1m width

Yingcai 1m Breiten-Stein-Muster-hydrodrucken-Film

Einheitspreis: US $ 1.6-2.5 / Square Meter
MOQ: 20 Quadratmeter

Bescheinigung:SGS
Art:Wassertransferdruck
Anwendung:Getränk,Medical Box,Leder,Cosmetic Box,TextilienKleidung
Warenzeichen:Yingcai
Verpackung:Hard Paper Tube
Standard:1m width

Qualität kundenspezifischer konkreter stapelweise verarbeitender Pflanzenpreis

Einheitspreis: US $ 256000.0-270000.0 / Stück
MOQ: 1 Stück

Art:Betonmischanlage
Spritzbeton-Typ:Semi-Dry
Bearbeitungsprozess:Hydraulisch
Struktur:Rotor
Produktivität:240㎡ / h
Feeding Höhe:1400mm

Harbin Zephyr Trading Co., Ltd.

[Provinz: Heilongjiang, China]

Anbieter Lieferant

Hochwertiges Brown-Farben-Weinlese-Chesterfield-Sofa

Einheitspreis: US $ 3500.0-4500.0 / Set
MOQ: 1 Set

Modell Nr.:A3
Stil:Antik
Sofa-Satz:1 + 3 + 1
Sitz:3
Rahmenmaterial:Holz
Polsterung:Schwamm

Shandong Qijia Furniture Co., Ltd.

[Provinz: Shanghai, China]

Anbieter Lieferant

Brauchen Sie Hilfe?
Kontaktieren Sie bitte uns.
Verwandte Schnellsuche Kategorien
Taschen spielen eine zentrale Rolle im Leben jeder Frau. Sie sind das A und O eines Outfits. Beziehen Sie die größte Auswahl an Taschen in Form von Schultertaschen, Rucksäcken, Handtaschen, Tragetaschen, Reisetaschen und vielen mehr von unseren geprüften Lieferanten aus China. Finden Sie ohne Umschweife Taschen online auf Made-in-China.com. Sie möchten gerne Säcke Verwendet fabrik und ähnliche Angebote, wie z. B. aufbewahrungsbeutel, mode-taschen, lock beutel importieren? Wählen Sie Ihr bevorzugtes Design von unseren oben gelisteten Lieferanten. Made-in-China.com bietet eine große Auswahl an Taschen & Beuteln, angefangen bei eleganten Handtaschen für besondere Anlässe, praktischen Schulter- und Umhängetaschen sowie weitere alltagstaugliche Ausführungen. Stellen Sie Ihre Anfrage auf unsere Webseite und nehmen Sie sofort Kontakt mit unseren Lieferanten auf. Finden Sie mit geringerem Aufwand die passenden Hersteller für Taschen, Etuis & Verpackungen. Zu uns kommen Sie, wenn Sie Geld sparen und neue Ideen für Ihren Tascheneinkaufsplan erhalten wollen.
Schnellproduktverzeichnis