Startseite » Koffer, Handtaschen und Geschenkkisten » Plastiktasche » Säcke verwendet
Schnellproduktverzeichnis Schnelllieferantenverzeichnis
Seite 1768/19354  
Insgesamt 580595 Produkte von etwa 18728

Säcke verwendet

Hersteller & Lieferanten
China-Lieferant - Gold-Mitglied
Sortieren nach: Relevanz
Zeigen: 30 artikel

Flexo Drucken-Maschinen-Druck-Papierbeutel, Papiercup (ZB - 650)

Referenz FOB Preis: US $ 35937.0-93750.0 / Set
MOQ: 1 Set

Modell Nr.:650
Drucken Page:Einseitig
Druckfarbe:6 Farben
Rasterwalze:Keramikrasterwalzen
Trockner:UV & IR
Art:Ink Jet

Laufendes Steady&Nbsp; Bandförderer-Produktion

Referenz FOB Preis: US $ 1000.0-30000.0 / Set
MOQ: 1 Set

Modell Nr.:ZK
Warenzeichen:ZK
Verpackung:Standard Export Packing
Standard:ISO9001, ISO14000, CE
Herkunft:Zhengzhou, China
Produktionskapazität:Customized

Geneigter Gummibandförderer/neigte Förderband-System

Referenz FOB Preis: US $ 5000.0-100000.0 / Set
MOQ: 1 Set

Modell Nr.:ZK
Struktur:Belt Conveyor
Material:Edelstahl
Material Eigenschaft:Brandschutz
Bescheinigung:ISO9001: 2008ISO9001: 2000
Energie Sparen:Energy Saving

Zubehör-Kurven-Abdachungs-Bandförderer

Referenz FOB Preis: US $ 5000.0-100000.0 / Set
MOQ: 1 Set

Modell Nr.:ZK
Struktur:Belt Conveyor
Material:Edelstahl
Material Eigenschaft:Brandschutz
Bescheinigung:ISO9001: 2008ISO9001: 2000
Energie Sparen:Energy Saving

Langer Beutel-Impuls-Staub-Sammler mit angemessenem Entwurf

Referenz FOB Preis: US $ 21000.0-100000.0 / Set
MOQ: 1 Set

Modell Nr.:ZK
Warenzeichen:ZK
Verpackung:Standard Export Packing
Standard:ISO9001, ISO14000, CE
Herkunft:Zhengzhou, China
HS-Code:8417

China-Polyester-Zementindustrie-Staubbeutel-Filter-Lieferant

Referenz FOB Preis: US $ 10000.0-39999.0 / Stück
MOQ: 1 Stück

Modell Nr.:ZK
Schindel:mit Schindel
Filter Anzahl:32
Medium Material:Edelstahlgewebe
Leistungsfähigkeit:F5
Filterfeinheit:Medium Filter

Heißer Seling horizontaler elektrostatischer Staub-Sammler

Referenz FOB Preis: US $ 1000.0-100000.0 / Set
MOQ: 1 Set

Modell Nr.:ZK
Warenzeichen:ZK
Verpackung:Standard Export Packing
Standard:ISO9001, ISO14000, CE
Herkunft:Zhengzhou, China
Produktionskapazität:Customized

Vertrauenswürdiger Staub-Sammler-Hersteller in China

Referenz FOB Preis: US $ 1000.0-100000.0 / Set
MOQ: 1 Set

Modell Nr.:ZK
Warenzeichen:ZK
Verpackung:Standard Export Packing
Standard:ISO9001, ISO14000, CE
Herkunft:Zhengzhou, China
Produktionskapazität:Reference to The Form

Hohes L Lysin-Nahrungsmittelgrad für Hühnerfutter-Lieferanten

Referenz FOB Preis: US $ 1 / Ton
MOQ: 1 Ton

Modell Nr.:lysine
Funktion:Amino Acid Additives
Warenzeichen:Fooding
Verpackung:25kg
Standard:GMP
Herkunft:China

Fooding Group Limited

[Provinz: Shanghai, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Automatische Getreide-Stab-Hochgeschwindigkeitsverpackungsmaschine

Referenz FOB Preis: US $ 8000.0-20000.0 / Sets
MOQ: 1 Sets

Modell Nr.:EV-350
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,KosmetikaSkin Care Produkte
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung

Automatischer rückseitiger Dichtungs-Beutel-horizontale Verpackungsmaschine

Referenz FOB Preis: US $ 40000.0-80000.0 / Sets
MOQ: 1 Sets

Modell Nr.:EV-500A
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,KosmetikaSkin Care Produkte
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Automatisches Buch-Hochgeschwindigkeitsverpackmaschine

Referenz FOB Preis: US $ 40000.0-80000.0 / Sets
MOQ: 1 Sets

Modell Nr.:EV-500A
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,KosmetikaSkin Care Produkte
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung

Halbautomatische Schokoriegel-horizontale Fluss-Verpackungsmaschine

Referenz FOB Preis: US $ 6000.0-10000.0 / Sets
MOQ: 1 Sets

Modell Nr.:EV-380
Automatischer Grad:Semi-Automatic
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Snack,ReismehlGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Halbautomatische Schokoriegel-Kissen-Verpackungsmaschine

Referenz FOB Preis: US $ 6000.0-10000.0 / Sets
MOQ: 1 Sets

Modell Nr.:EV-380
Automatischer Grad:Semi-Automatic
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Snack,ReismehlGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Medizinische Maschine des Automobil-CPAP mit Cer (CPAP09)

Referenz FOB Preis: US $ 200.0-500.0 / Stück
MOQ: 1 Stück

Modell Nr.:CPAP09
Medical Device Regulatory Typ:Typ 2
Warenzeichen:OEM
Verpackung:Seaworthy Packing
Standard:CE, ISO13485
Herkunft:China

Selbst-CPAP Maschine des Haushalts-mit Cer (CPAP09)

Referenz FOB Preis: US $ 200.0-500.0 / Stück
MOQ: 1 Stück

Modell Nr.:CPAP09
Medical Device Regulatory Typ:Typ 2
Warenzeichen:OEM
Verpackung:Seaworthy Packing
Standard:CE, ISO13485
Herkunft:China

Kundenspezifisches springendes Vagabund-Eignung-Trampoline-Innenset

Referenz FOB Preis: US $ 3000.0-50000.0 / Set
MOQ: 1 Set

Modell Nr.:GT015
Art:Bungee-Trampolin
Max Jumping Gewicht:≥ 100kg
Verwendung:Innen-
Material:Steel Pipe + Nylon Mesh + Frühling
Farbe:Multicolor

Einseitige Ausstellung-Metallbildschirmanzeige-Regal-Zahnstange für Speicher

Referenz FOB Preis: US $ 59.9-138.8 / Stück
MOQ: 50 Stück

Modell Nr.:DR114
Gefaltete:Entfaltete
BUILD-Methode:Standsäule
Feature:Recycelt
Material:Metall
Art:L Ständer

Foshan Giantmay Metal Production Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Kleine Chef Mbbr Filter-Media

Referenz FOB Preis: US $ 300 / Square Meter
MOQ: 10 Quadratmeter

Modell Nr.:PE
Material:PE
Warenzeichen:small boss
Verpackung:0.1m3/Bag
Standard:12*9mm
Herkunft:China

Industrielle Impuls-Strahlen-Luft-Typen Kassetten-Staub-Sammler-Filter

Referenz FOB Preis: US $ 3000.0-18000.0 / Stück
MOQ: 1 Stück

Modell Nr.:MLT
Bescheinigung:CEISO
Installationsmethode:Vertikal
Operationstyp:Automatische
Medium Material:Chemical Synthetic Fiber
Staubsammelmethode:Trocken

Heißer Verkaufs-Staub-Sammler-Filtereinsatz für Maschinen

Referenz FOB Preis: US $ 1550.0-5110.0 / Stück
MOQ: 1 Stück

Bescheinigung:CEISO
Installationsmethode:Vertikal
Operationstyp:Automatische
Medium Material:Chemical Synthetic Fiber
Staubsammelmethode:Trocken
Art:Stoff Staubfänger

Holzbearbeitung-Staub-Ansammlung Baghouse Filter

Referenz FOB Preis: US $ 1550.0-5110.0 / Stück
MOQ: 1 Stück

Bescheinigung:CEISO
Installationsmethode:Vertikal
Operationstyp:Automatische
Medium Material:Chemical Synthetic Fiber
Staubsammelmethode:Trocken
Art:Stoff Staubfänger

Zementindustrie-Ofen zentrifugaler Baghouse Staub-Sammler

Referenz FOB Preis: US $ 1550.0-5110.0 / Stück
MOQ: 1 Stück

Bescheinigung:CEISO
Installationsmethode:Vertikal
Operationstyp:Automatische
Medium Material:Chemical Synthetic Fiber
Staubsammelmethode:Trocken
Art:Stoff Staubfänger

Heißer Verkaufs-Beutel-Typ ISOsgs-Bescheinigung-Staub-Sammler

Referenz FOB Preis: US $ 1550.0-5110.0 / Stück
MOQ: 1 Stück

Bescheinigung:CEISO
Installationsmethode:Vertikal
Operationstyp:Automatische
Medium Material:Chemical Synthetic Fiber
Staubsammelmethode:Trocken
Art:Stoff Staubfänger

Staub-Sammler-Maschine für Holzbearbeitung Baghouse

Referenz FOB Preis: US $ 1550.0-5110.0 / Stück
MOQ: 1 Stück

Bescheinigung:CEISO
Installationsmethode:Vertikal
Operationstyp:Automatische
Medium Material:Chemical Synthetic Fiber
Staubsammelmethode:Trocken
Art:Stoff Staubfänger

Industrieller Niederdruck-Umweltschutz-Impuls-Beutelfilter

Referenz FOB Preis: US $ 1550.0-5110.0 / Stück
MOQ: 1 Stück

Bescheinigung:CEISO
Installationsmethode:Vertikal
Operationstyp:Automatische
Medium Material:Chemical Synthetic Fiber
Staubsammelmethode:Trocken
Art:Stoff Staubfänger

Industrieller Staub-Filtration-Staub, der den Staub entfernt Systeme entfernt

Referenz FOB Preis: US $ 1550.0-5110.0 / Stück
MOQ: 1 Stück

Bescheinigung:CEISO
Installationsmethode:Vertikal
Operationstyp:Automatische
Medium Material:Chemical Synthetic Fiber
Staubsammelmethode:Trocken
Art:Stoff Staubfänger

Beutel-Umweltschutz-Ofen entstauben Filter-Gerät

Referenz FOB Preis: US $ 1550.0-5110.0 / Stück
MOQ: 1 Stück

Bescheinigung:CEISO
Installationsmethode:Vertikal
Operationstyp:Automatische
Medium Material:Chemical Synthetic Fiber
Staubsammelmethode:Trocken
Art:Stoff Staubfänger

Einzelner Impuls-Beutel-Laser-Ausschnitt-Staub-Sammler

Referenz FOB Preis: US $ 1550.0-5110.0 / Stück
MOQ: 1 Stück

Bescheinigung:CEISO
Installationsmethode:Vertikal
Operationstyp:Automatische
Medium Material:Chemical Synthetic Fiber
Staubsammelmethode:Trocken
Art:Stoff Staubfänger

Qualitäts-Staub, der Extraktion-Systeme entfernt

Referenz FOB Preis: US $ 1550.0-5110.0 / Stück
MOQ: 1 Stück

Bescheinigung:CEISO
Installationsmethode:Vertikal
Operationstyp:Automatische
Medium Material:Chemical Synthetic Fiber
Staubsammelmethode:Trocken
Art:Stoff Staubfänger
Brauchen Sie Hilfe?
Kontaktieren Sie bitte uns.
Verwandte Schnellsuche Kategorien
Taschen spielen eine zentrale Rolle im Leben jeder Frau. Sie sind das A und O eines Outfits. Beziehen Sie die größte Auswahl an Taschen in Form von Schultertaschen, Rucksäcken, Handtaschen, Tragetaschen, Reisetaschen und vielen mehr von unseren geprüften Lieferanten aus China. Finden Sie ohne Umschweife Taschen online auf Made-in-China.com. Sie möchten gerne Säcke Verwendet fabrik und ähnliche Angebote, wie z. B. aufbewahrungsbeutel, mode-taschen, lock beutel importieren? Wählen Sie Ihr bevorzugtes Design von unseren oben gelisteten Lieferanten. Made-in-China.com bietet eine große Auswahl an Taschen & Beuteln, angefangen bei eleganten Handtaschen für besondere Anlässe, praktischen Schulter- und Umhängetaschen sowie weitere alltagstaugliche Ausführungen. Stellen Sie Ihre Anfrage auf unsere Webseite und nehmen Sie sofort Kontakt mit unseren Lieferanten auf. Finden Sie mit geringerem Aufwand die passenden Hersteller für Taschen, Etuis & Verpackungen. Zu uns kommen Sie, wenn Sie Geld sparen und neue Ideen für Ihren Tascheneinkaufsplan erhalten wollen.
Schnellproduktverzeichnis