Startseite » Produktionsmaschinen » Injektionsumformanlage » Gebrauchte Moulding Machines
Schnellproduktverzeichnis Schnelllieferantenverzeichnis
Seite 542/4669  
Insgesamt 140049 Produkte von etwa 5386

Gebrauchte Moulding Machines

Hersteller & Lieferanten
China-Lieferant - Gold-Mitglied
Sortieren nach: Relevanz
Zeigen: 30 artikel

Faser-Laser-Markierungs-Maschine 50W

Einheitspreis: US $ 3755.29-6755.39 / Stück
MOQ: 1 Stück

Modell Nr.:P-FB-10W/20W/30W
Laser-Sichtbarkeit:Sichtbar
Zutreffend Material:Metall
Kühlsystem:Luftkühlung
Technische Klasse:Kurzpulslaser
Laser-Wellenlänge:Faserlaser

Suzhou Prato Laser Technology Co., Ltd.

[Provinz: Jiangsu, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Laser-Markierungs-Maschine für Aluminium

Einheitspreis: US $ 3755.29-6755.39 / Stück
MOQ: 1 Stück

Modell Nr.:P-FB-10W/20W/30W
Laser-Sichtbarkeit:Sichtbar
Zutreffend Material:Metall
Kühlsystem:Luftkühlung
Technische Klasse:Kurzpulslaser
Laser-Wellenlänge:Faserlaser

Suzhou Prato Laser Technology Co., Ltd.

[Provinz: Jiangsu, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Metall-u. Nichtmetall-Faser-Laser-Markierungs-Gravierfräsmaschine

Einheitspreis: US $ 3755.29-6755.39 / Stück
MOQ: 1 Stück

Modell Nr.:P-FB-10W/20W/30W
Laser-Sichtbarkeit:Sichtbar
Zutreffend Material:Metall
Kühlsystem:Luftkühlung
Technische Klasse:Kurzpulslaser
Laser-Wellenlänge:Faserlaser

Suzhou Prato Laser Technology Co., Ltd.

[Provinz: Jiangsu, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Qualitäts-Faser-Metalllaser-Markierungs-Maschine für Ich-Auflage, iPhone/Apple

Einheitspreis: US $ 3755.29-6755.39 / Stück
MOQ: 1 Stück

Modell Nr.:P-FB-10W/20W/30W
Laser-Sichtbarkeit:Sichtbar
Zutreffend Material:Metall
Kühlsystem:Luftkühlung
Technische Klasse:Kurzpulslaser
Laser-Wellenlänge:Faserlaser

Suzhou Prato Laser Technology Co., Ltd.

[Provinz: Jiangsu, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

10W 20W 30W 50W bewegliche Faser-Laser-Markierungs-Maschine

Einheitspreis: US $ 3755.29-6755.39 / Stück
MOQ: 1 Stück

Modell Nr.:P-FB-10W/20W/30W
Laser-Sichtbarkeit:Sichtbar
Zutreffend Material:Metall
Kühlsystem:Luftkühlung
Technische Klasse:Kurzpulslaser
Laser-Wellenlänge:Faserlaser

Suzhou Prato Laser Technology Co., Ltd.

[Provinz: Jiangsu, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Gute China-automatische Bier-Glasflaschen-Füllmaschine

Einheitspreis: US $ 10000.0-38000.0 / Stück
MOQ: 1 Stück

Modell Nr.:DCGFC
Art:Volumetrische Füllmaschine
Automatischer Grad:Vollautomatische
Medientyp:Granular
Füllventil Leiter:Muti-Head
Feed-Zylinderstruktur:Multi-Room Feeding

Zapfwellenantrieb-Rollen-bewegliche flache sterben hölzerne Tabletten-Maschine mit Traktor

Einheitspreis: US $ 500.0-5000.0 / Stück
MOQ: 1 Stück

Modell Nr.:MKL229P
Art:Flache Die Platen Rad
Automatischer Grad:Automatisch
Controlling-Modus:CNC
Energie Sparen:Energy Saving
Bescheinigung:CE,ISOSGS

Laizhou Chengda Machinery Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Strukturierte Sojabohnenöl-Protein-Maschine, Protein-Fleisch, das Maschine herstellt

Einheitspreis: US $ 10000.0-25000.0 / Set
MOQ: 1 Set

Modell Nr.:KS-65
Energiequelle:Elektro
Automatischer Grad:Automatische
Spannung:380V
Kundenspezifische:Kundenspezifische
Verpackung:Wooden Case

Jinan Keysong Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Hochgeschwindigkeitsdrehblasformen-Maschine

Einheitspreis: US $ 10000.0-1000000.0 / Stück
MOQ: 1 Stück

Modell Nr.:Hy-Filling
Art:Wäge-type Füllmaschine
Automatischer Grad:Automatisch
Medientyp:Flüssigkeit
Füllventil Leiter:Muti-Head
Feed-Zylinderstruktur:Multi-Room Feeding

Volle automatische Drehblasformen-Maschine

MOQ: 1 Stück

Modell Nr.:HY-Filling
Art:Streckblasmaschine
Rohstoff:PET
Herstellungsverfahren von Parison:Streckblasmaschine
Automatisierung:Automatisch
Computerized:Computerized

Emulsion-UVberührungs-Maschine des Klischee-Tmep-4050 mit Vakuum

Einheitspreis: US $ 400 / Set
MOQ: 1 Set

Modell Nr.:Tmep-4050
Art:Plattenbelichtung
Seite:Einseitig
Automatischer Grad:Automatisch
Produkttyp:Daily Use
Proximity Exposure:Vakuum-Kontakt

Tamprinter Printing Machinery Limited

[Provinz: Guangdong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Jaten Bock-automatischer Anblick-messende Maschine (Millivolt-Serien)

Einheitspreis: US $ 30433 / Stück
MOQ: 1 Stück

Modell Nr.:MV7070CNC
Anwendung:Metall
Prozessnutzung:Metal-Forming CNC Machine Tools
Bewegung Method:Contour Control
Steuerungsmethode:Closed-Loop Control
Numerical Control:CNC / MNC

Dongguan Jaten Instrument Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Yv-300A Haustier-Vorformling-Schlag-Ausdehnungs-durchbrennenmaschine

Einheitspreis: US $ 14000 / Stück
MOQ: 1 Stück

Modell Nr.:YV-300A
Art:Streckblasmaschine
Rohstoff:PET
Herstellungsverfahren von Parison:Streckblasmaschine
Automatisierung:Automatisch
Computerized:Computerized

Yuhuan Tonva Plastics Machine Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

ENV-Form-Formteil-Maschine für Icf Formteil-Maschine

MOQ: 1 Set

Modell Nr.:FW-Z1513JN-BB
Art:EPS Foam Machine
Automatisierung:Automatisch
Computerized:Computerized
Bescheinigung:CE,ISO9001: 2008SGS
Warenzeichen:Fuwei EPS Machinery

Multi Station BOPS PlastikThermoforming Maschine für das Verpacken der Lebensmittel

Einheitspreis: US $ 90000.0-110000.0 / Stück
MOQ: 1 Stück

Modell Nr.:XG-A
Zertifizierung:CEICH SO
Warenzeichen:XG-Machine
Verpackung:Standard Export Wooden Case Packing
Standard:600x760mm
Herkunft:China

Full-Automatic 3 Station PlastikThermoforming Maschine

Einheitspreis: US $ 90000.0-110000.0 / Stück
MOQ: 1 Stück

Modell Nr.:XG-A
Zertifizierung:CEICH SO
Spaltennummer:Viersäulen
Warenzeichen:XG-Machine
Verpackung:Standard Export Wooden Case Packing
Standard:600x760mm

Icesta Block-Eis-Zerkleinerungsmaschine-Maschine

Einheitspreis: US $ 1000.0-80000.0 / Set
MOQ: 1 Set

Modell Nr.:ICR-10
Eisherstellung:Fließend
Kühl Way:Luftgekühlte
Automatisierung:Automatisierung
Geräteaufbau:Integral
Maschinen-Größe:Groß

Shenzhen Brother Ice System Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Hfb540m manueller Betonstein, der Maschine herstellt

Einheitspreis: US $ 6000.0-7000.0 / Set
MOQ: 1 Set

Modell Nr.:HFB540M
Zertifizierung:SGS,CEICH SO
Kundenspezifische:Kundenspezifische
Automatischer Grad:Halbautomatisch
Art:Vibration Molding
Warenzeichen:HONGFA

2017 Hochgeschwindigkeitsverpackmaschine/Vakuum, das Maschine mit Servomotor bildet

Einheitspreis: US $ 35000.0-40000.0 / Stück
MOQ: 1 Stück

Modell Nr.:XG-D
Zertifizierung:CEICH SO
Spaltennummer:Viersäulen
Automatischer Grad:Automatisch
Warenzeichen:XG-Machinery
Verpackung:Standard Export Wooden Case Packing

Qualitäts-Heizung und halb bildendes Selbstplastikmaschinell hergestelltes in China

MOQ: 1 Set

Modell Nr.:CWZ-180Z + RH-03
Art:Streckblasmaschine
Rohstoff:PET
Herstellungsverfahren von Parison:Streckblasmaschine
Automatisierung:Non-Automatic
Computerized:Computerized

Fogang County Guozhu Plastic Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Sehr heiße Verkaufs-Multifunktionshalb Selbsthaustier-Flaschen-durchbrennenmaschine

Einheitspreis: US $ 11000 / Set
MOQ: 1 Set

Modell Nr.:CWZ-180Z + RH-01
Art:Streckblasmaschine
Rohstoff:PET
Herstellungsverfahren von Parison:Streckblasmaschine
Automatisierung:Non-Automatic
Computerized:Computerized

Fogang County Guozhu Plastic Co., Ltd.

[Provinz: Guangdong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Metallüberwurfmutter-Maschine

MOQ: 1 Stück

Modell Nr.:YFX-1
Zustand:Neu
Kundenspezifische:Kundenspezifische
Zusammensetzung:Füllmaschine
Warenzeichen:New Crown
Verpackung:Wooden Case

Qtj4-25b halbautomatische konkrete Ziegelstein-Rolle, die Maschine bildet

Einheitspreis: US $ 6000.0-7000.0 / Set
MOQ: 1 Set

Modell Nr.:QTJ4-25B
Zertifizierung:SGS,CEICH SO
Kundenspezifische:Kundenspezifische
Automatischer Grad:Halbautomatisch
Art:Vibration Molding
Warenzeichen:HONGFA

Qtj4-25b Schwingung kundenspezifisches konkretes Bolck, das Maschine herstellt

Einheitspreis: US $ 6000.0-7000.0 / Set
MOQ: 1 Set

Modell Nr.:QTJ4-25B
Zertifizierung:SGS,CEICH SO
Kundenspezifische:Kundenspezifische
Automatischer Grad:Halbautomatisch
Art:Vibration Molding
Warenzeichen:HONGFA

Qt6-15b automatische Schwingung-Formteil-Betonstein-Rolle, die Maschine bildet

Einheitspreis: US $ 30000.0-60000.0 / Set
MOQ: 1 Set

Modell Nr.:QT6-15B
Zertifizierung:SGS,CEICH SO
Kundenspezifische:Kundenspezifische
Automatischer Grad:Automatisch
Art:Hydraulische Stoßdämpfer
Warenzeichen:HONGFA

Qt6-15b hohe Leistungsfähigkeits-Kleber-Höhlung-Block, der Maschine herstellt

Einheitspreis: US $ 30000.0-60000.0 / Set
MOQ: 1 Set

Modell Nr.:QT6-15B
Zertifizierung:SGS,CEICH SO
Kundenspezifische:Kundenspezifische
Automatischer Grad:Automatisch
Art:Hydraulische Stoßdämpfer
Warenzeichen:HONGFA

Qt6-15b deutscher Technologie-Pflasterung-Stein-Block, der Maschine herstellt

Einheitspreis: US $ 30000.0-60000.0 / Set
MOQ: 1 Set

Modell Nr.:QT6-15B
Zertifizierung:SGS,CEICH SO
Kundenspezifische:Kundenspezifische
Automatischer Grad:Automatisch
Art:Hydraulische Stoßdämpfer
Warenzeichen:HONGFA

Beste verkaufende konkrete Ziegelstein-Maschine des vollautomatischen Kleber-Qt5-15

Einheitspreis: US $ 30000.0-60000.0 / Set
MOQ: 1 Set

Modell Nr.:QT5-15
Zertifizierung:SGS,CEICH SO
Kundenspezifische:Kundenspezifische
Automatischer Grad:Automatisch
Art:Hydraulische Stoßdämpfer
Warenzeichen:HONGFA

Energiesparende Betonstein-Pflasterung-Steine des Kleber-Qt5-15, die Maschine herstellen

Einheitspreis: US $ 30000.0-60000.0 / Set
MOQ: 1 Set

Modell Nr.:QT5-15
Zertifizierung:SGS,CEICH SO
Kundenspezifische:Kundenspezifische
Automatischer Grad:Automatisch
Art:Hydraulische Stoßdämpfer
Warenzeichen:HONGFA

Populärer konkreter Ziegelstein-Pflasterstein des Kleber-Qt5-15, der Maschine herstellt

Einheitspreis: US $ 30000.0-60000.0 / Set
MOQ: 1 Set

Modell Nr.:QT5-15
Zertifizierung:SGS,CEICH SO
Kundenspezifische:Kundenspezifische
Automatischer Grad:Automatisch
Art:Hydraulische Stoßdämpfer
Warenzeichen:HONGFA
Brauchen Sie Hilfe?
Kontaktieren Sie bitte uns.
Verwandte Schnellsuche Kategorien
Haben Sie Schwierigkeiten bei der Suche nach Gebrauchte Moulding Machines fabrik und zuverlässigen Partnern in China? Eine Lösung kann hier, in unserer umfassenden und aktualisierten Datenbank führender chinesischer Maschinenhersteller, gefunden werden. Eine große Anzahl qualifizierter Zulieferer der Fertigungs- & Verarbeitungsindustrie werden Ihnen ihre neuesten Maschinen und Technologien präsentieren. Wie wir wissen, beinhaltet die Suche nach guten Lieferanten viel mehr als das Scannen einer Reihe von Preislisten. Die richtige Internet-Handelsplattform auszuwählen, kann das wertvollste Instrument im Streben nach wirtschaftlichem Erfolg und Expansion sein. Unsere Webseite ist ein weltweit führendes B2B-Portal, auf dem unsere Mitglieder eine breite Auswahl an Qualitätsmaschinen und Anlagen präsentieren. Sie bieten außerdem Hightech-Maschinen und Werkzeuge, angefangen bei kunststoff- maschine, benutzerdefinierte kunststoff-form, gebrauchte spritzgießmaschinen. Wir heißen alle globalen Einkäufer willkommen, um mit Anbietern aus China für eine glänzende Zukunft zusammenzuarbeiten. Seriös, Zuverlässig & Innovativ. Große Produktvielfalt. Erkundigen Sie sich jetzt bei unseren Lieferanten.
Schnellproduktverzeichnis