Startseite » Landwirtschaft & Essen » Getreide und Korn » Mehl Lebensmittel
Schnellproduktverzeichnis Schnelllieferantenverzeichnis
Seite 46/1915  
Insgesamt 57447 Produkte von etwa 2872

Mehl Lebensmittel

Hersteller & Lieferanten
China-Lieferant - Gold-Mitglied
Sortieren nach: Relevanz
Zeigen: 30 artikel

Automatischer Papierserviette-Verpackungsmaschine-Preis

Referenz FOB Preis: US $ 5000.0-7000.0 / Set
MOQ: 1 Set

Modell Nr.:AB-450
Automatischer Grad:Automatisch
Anwendung:Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Gemüse Obst,Fisch, Fleisch,SnackReismehl
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung

Wenzhou Anbo Machinery Co.,Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Doppelzimmer-Lack-Karosserien-vakuumverpackende Maschine (DZ-900/2SB)

Referenz FOB Preis: US $ 200.0-2000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, CIP, EXW

Modell Nr.:DZ-900/2SB
Verpackung:Tasche
Automatischer Grad:Semi-Automatic
Verpackungsmaterial:Kunststoff
Anwendung:Kosmetika,Reinigung, Reinigungsmittel,Getränke,Öl,Milchprodukte,Skin Care Produkte,Hair Care Produkte,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Verwendung:Innere Verpackung

Wenzhou Fable Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Preiswerter Form-Zoll aufbereitete Papiertüten

Referenz FOB Preis: US $ 0.2-0.9 / Stück
MOQ: 500 Stück

Modell Nr.:paper bag-008A
Kundenspezifische:Kundenspezifische
Papiertyp:Karton
Verwendung:Geschenke,Kosmetikum,Kunst und Handwerk,Essen,Elektronische Produkte,Schmuck,Garment & Shoes,Gesundheitspflege-ProdukteGrußkarten, Briefe
Form:Rechteck
Firmenzeichen-Drucken:Mit Firmenzeichen-Drucken

Küche-Geräten-Qualitäts-Ei-Mischer-Mehl-Mischmaschine-Preis

Referenz FOB Preis: US $ 200.0-800.0 / Stück
MOQ: 1 Stück

Modell Nr.:B10
Verwendung:Keks,Kuchen,PizzaBrot
Energiequelle:Elektro
Zeitmessgerät:Ohne Zeitmessgerät
Art:Mixer
Spannung:220V

Henan Yearmega Industry Co., Ltd.

[Provinz: Henan, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Pp. gesponnener Beutel für Verpackung

Referenz FOB Preis: US $ 1250.0-1960.0 / Ton
MOQ: 5 Tonnen
Handelsbedingungen: FOB, CFR, CIF, DAT, FAS, DDP, DAP, CIP, CPT, FCA, EXW

Modell Nr.:SG-PB-01
Material:PP
Anwendung:Lebensmittel,FutterDünger
Art:Woven-Bag
Technics:Plastiktaschen
Warenzeichen:SG GLOBAL

Qingdao SG Global Packaging Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Niedriger Preis-Abfall-Beutel für verpackenbaumwolle/Kleidung

Referenz FOB Preis: US $ 0.15-0.2 / Stück
MOQ: 100000 Stück

Modell Nr.:75*113
Anwendung:Lebensmittel,Förderung,Haushalt,ChemikalieKleider
Feature:RecycelbarAntistatisch
Material:PP
Form:Plastiktaschen
Prozess:Plastic Packaging Taschen

Shijiazhuang Han Hao Trade Co., Ltd.

[Provinz: Hebei, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Weizen-Mehl-Fräsmaschine des europäischen Standard-50t pro Tag

Referenz FOB Preis: US $ 10000.0-12000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, CIP, CPT, FCA, EXW

Modell Nr.:50T per Day
Kundenspezifische:Kundenspezifische
Bescheinigung:CEISO 9001
Energiequelle:Elektro
Automatischer Grad:Semi-Automatic
Warenzeichen:HDF

Großhandelspreis-Nahrungsmittelgeräten-Teig Sheeter für Bäckerei

Referenz FOB Preis: US $ 1371.0-1569.0 / Stück
MOQ: 5 Stück

Modell Nr.:BDQ-520C
Verwendung:KeksBrot
Energiequelle:Elektro
Zeitmessgerät:Ohne Zeitmessgerät
Kundenspezifische:Kundenspezifische
Warenzeichen:Bossda/OEM

Cer Stnadard volle automatische Mais-Imbisse Kurkure Herstellungs-Maschine

Referenz FOB Preis: US $ 11000 / Stück
MOQ: 1 Stück

Modell Nr.:DLG-76
Bescheinigung:CEISO 9001
Energiequelle:Elektro
Verarbeiten:Thermal Processing
Automatischer Grad:Automatische
Anwendung:Süßigkeiten,Popcorn,Pommes frites,KeksKrapfen

Halbautomatische flache Etikettiermaschine (MT-60)

Referenz FOB Preis: US $ 670.0-830.0 / Stück
MOQ: 1 Stück

Modell Nr.:MT-60
Automatischer Grad:Semi-Automatic
Anwendung:Kosmetika,Reinigung, Reinigungsmittel,Skin Care Produkte,Hair Care Produkte,Öl,Tee,Fisch, Fleisch,Snack,Reismehl,GewürzMilchprodukte
Art:Automatische Etikettiermaschine
Driven Type:Elektrisch
Klassifikation:Flugzeug-Etikettiermaschine

Rückseitige Dichtungs-energiesparende Hochgeschwindigkeitsverpackmaschine (DXD-520F)

Referenz FOB Preis: US $ 20000.0-21500.0 / Set
MOQ: 1 Set

Modell Nr.:DXD-520F
Automatischer Grad:Automatisch
Anwendung:Milchprodukte,Snack,ReismehlGewürz
Art:Und Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Ruian Haicheng Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Fabrik-preiswerter Imbiss-Nahrungsmittelextruder-Mais-Hauch, der Maschinen herstellt

Referenz FOB Preis: US $ 2000.0-10000.0 / Stück
MOQ: 1 Stück

Modell Nr.:DGP corn puff snack extruder
Bescheinigung:CEISO 9001
Energiequelle:Elektro
Verarbeiten:Ferment
Automatischer Grad:Automatische
Anwendung:Süßigkeiten,Popcorn,Pommes fritesKeks

Stangenbohrer-Puder-Füllmaschine für Peper Puder

Referenz FOB Preis: US $ 10000.0-20000.0 / Stück
MOQ: 1 Stück

Modell Nr.:AF1000
Art:Volumetrische Füllmaschine
Automatischer Grad:Semi-Automatic
Medientyp:Pulver
Füllventil Leiter:Single-Head
Feed-Zylinderstruktur:Einzel-Zimmer Feeding

Jiabo Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Automatische horizontale Granulars Nuts Verpackungsmaschine

Referenz FOB Preis: US $ 32500.0-53000.0 / Sets
MOQ: 1 Sets
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:EV-240S
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Snack,ReismehlGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Selbst-Stehender pp.-grosser Beutel-Masse-Beutel

Referenz FOB Preis: US $ 4.0-7.0 / Stück
MOQ: 1000 Stück
Handelsbedingungen: FOB, CFR, CIF, EXW

Modell Nr.:Self Stand bag 01
Material:PP
Anwendung:Chemikalie
Art:FIBC Bag
Loop-Option:Side-Seam-Schleife
Sicherheitsfaktor:5.01

Qingdao Baigu Plastic Products Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Nasser sofortiger neuer Konjac Shirataki Isolationsschlauch-Nudel-Gewicht-Verlust

Referenz FOB Preis: US $ 18.0-40.0 / Box
MOQ: 200 Boxen

Modell Nr.:A12-008
Bescheinigung:BRC,ISO,FDAHACCP
Verpackungsmaterial:Kunststoff
Speichermethode:Normal
Haltbarkeit:6 Monate-12 Monate
Art:Fast Food

Shanghai Benefisha Industrial Co., Ltd.

[Provinz: Shanghai, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Automatische Mehlkloß Samosa Sprung-Multifunktionsrolle, die Hersteller-Maschine herstellt

Referenz FOB Preis: US $ 1680 / Stück
MOQ: 1 Stück

Modell Nr.:CE, CO, BV
Spannung:220V
Aussehen:Vertikal
Press Series:Zweite
Zustand:Neu
Kundenspezifische:Kundenspezifische

Golden Machinery Equipment Co., Ltd.

[Provinz: Henan, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

USA-Standardgravüre-Drucken-Tee-verpackenbeutel

Referenz FOB Preis: US $ 0.05-0.9 / Stück
MOQ: 20000 Stück

Modell Nr.:ZB-020
Feature:Moisture Proof
Material:Schichtwerkstoff
Form:Spezialtasche
Prozess:Verbundverpackungsbeutel
Rohstoffe:Hochdruck-Polyethylen Plastic Bag

Qingdao Zhongbang Packaging Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Selbstbeutel-Füllmaschine-Düngemittel-Korn-Verpacken-Maschinerie

Referenz FOB Preis: US $ 3500.0-5500.0 / set
MOQ: 1 set

Modell Nr.:DCS-10A
Automatischer Grad:Automatisch
Anwendung:Reismehl
Art:Und Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Automatische Mehl-Milch-Puder-Quetschkissen-Verpackungsmaschine

Referenz FOB Preis: US $ 3000.0-5000.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF

Modell Nr.:FB-100P
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Tee,Snack,ReismehlGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Driven Type:Elektrisch

Wenzhou Fable Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Hochwertige preiswerte kundenspezifische Papiertüten Kraftpapier

Referenz FOB Preis: US $ 0.2-0.9 / Stück
MOQ: 500 Stück

Modell Nr.:paper bag-010A
Kundenspezifische:Kundenspezifische
Papiertyp:Karton
Verwendung:Geschenke,Kosmetikum,Kunst und Handwerk,Essen,Elektronische Produkte,Schmuck,Garment & Shoes,Gesundheitspflege-ProdukteGrußkarten, Briefe
Form:Rechteck
Firmenzeichen-Drucken:Mit Firmenzeichen-Drucken

Kapazitäts-Tisch-oberster elektrischer Teig Sheeter des Walzen-4kg

Referenz FOB Preis: US $ 1500.0-1800.0 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CIF, EXW

Modell Nr.:BC-400T
Verwendung:Keks,Kuchen,PizzaBrot
Energiequelle:Elektro
Zeitmessgerät:Ohne Zeitmessgerät
Art:Ofen
Spannung:220V

60X90cm pp. gesponnener Beutel-Weizen-Mehl-Sack

Referenz FOB Preis: US $ 1250.0-1960.0 / Ton
MOQ: 5 Tonnen
Handelsbedingungen: FOB, CFR, CIF, DAT, FAS, DDP, DAP, CIP, CPT, FCA, EXW

Modell Nr.:SG-PB-01
Material:PP
Anwendung:Lebensmittel,FutterDünger
Art:Woven-Bag
Technics:Plastiktaschen
Warenzeichen:SG GLOBAL

Qingdao SG Global Packaging Co., Ltd.

[Provinz: Shandong, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Transparenter gesponnener Beutel für verpackenreis-Mehl

Referenz FOB Preis: US $ 0.15-0.2 / Stück
MOQ: 100000 Stück

Modell Nr.:10kg/20kg/25kg/40kg/50kg
Anwendung:Lebensmittel,Förderung,Haushalt,ChemikalieKleider
Feature:RecycelbarAntistatisch
Material:PP
Form:Plastiktaschen
Prozess:Plastic Packaging Taschen

Shijiazhuang Han Hao Trade Co., Ltd.

[Provinz: Hebei, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Special für Mais-Fräsmaschine Kenia-30t/24h

Referenz FOB Preis: US $ 39000.0-45000.0 / Set
MOQ: 1 Set
Handelsbedingungen: FOB, CFR, CIF, FAS, CIP, CPT, FCA, EXW

Modell Nr.:30T/24H
Art:Flour Mill
Anwendung:Mehl
Spannung:380V
Aussehen:Vertikal
Pressematerial:Mais

Automactic Walzen-Teig Sheeter mit Cer Bdq-650z

Referenz FOB Preis: US $ 6791.2-7258.0 / Stück
MOQ: 2 Stück

Modell Nr.:BDQ-650z
Verwendung:KeksBrot
Energiequelle:Elektro
Zeitmessgerät:Ohne Zeitmessgerät
Kundenspezifische:Kundenspezifische
Warenzeichen:Bossda/OEM

Vertikaler Puder-Beutel-füllende und Verpackmaschine für Imbiß (YL-120)

Referenz FOB Preis: US $ 3450.0-3850.0 / Stück
MOQ: 1 Stück

Modell Nr.:YL-120
Automatischer Grad:Automatisch
Anwendung:Reinigung, Reinigungsmittel,Kosmetika,Getränke,Skin Care Produkte,Milchprodukte,Hair Care Produkte,Öl,Tee,Gemüse Obst,Fisch, Fleisch,Snack,ReismehlGewürz
Art:Bildung Füllung Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung

Vier-Seite, die energiesparende Hochgeschwindigkeitsverpackmaschine (DXD-520F, dichtet)

Referenz FOB Preis: US $ 20000.0-21500.0 / Set
MOQ: 1 Set

Modell Nr.:DXD-520F
Automatischer Grad:Automatisch
Anwendung:Milchprodukte,Snack,ReismehlGewürz
Art:Und Verschließmaschine
Enden Spezies:Bag Moulding
Bildungsfunktion:Bildung,FüllungDichtung

Ruian Haicheng Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com

Des Fabrik-Hauch-Extruder direkt Mais-100kg/H, der Maschine herstellt

Referenz FOB Preis: US $ 2000.0-10000.0 / Stück
MOQ: 1 Stück

Modell Nr.:DGP snack food extruder
Bescheinigung:CEISO 9001
Energiequelle:Elektro
Verarbeiten:Ferment
Automatischer Grad:Automatische
Anwendung:Süßigkeiten,Popcorn,Pommes fritesKeks

Stangenbohrer-Puder-Füllmaschine für Protein-Puder

Referenz FOB Preis: US $ 10000.0-20000.0 / Stück
MOQ: 1 Stück

Modell Nr.:AF1000
Art:Volumetrische Füllmaschine
Automatischer Grad:Semi-Automatic
Medientyp:Pulver
Füllventil Leiter:Single-Head
Feed-Zylinderstruktur:Einzel-Zimmer Feeding

Jiabo Machinery Co., Ltd.

[Provinz: Zhejiang, China]

Anbieter Lieferant

China-Lieferant - Gold-Mitglied Audited Supplier of Made-in-China.com
Brauchen Sie Hilfe?
Kontaktieren Sie bitte uns.
Verwandte Schnellsuche Kategorien
Durchsuchen Sie unsere SGS geprüfte Datenbank von Agrar-Zulieferern und setzen Sie sich mit den besten Lebensmittel-Profis in Verbindung, die jede Ihre Nachfrage decken können. Finden Sie heraus, welche Auswirkung ein Qualitätsanbieter von Obst & Gemüse auf Ihre zukünftige Geschäftsentwicklung haben kann. Wir dienen als umfassende Quelle von Agrar- & Lebensmittelherstellern quer durch China, und hier ist die Liste der Bezugsquellen / Hersteller, die mit Ihrer Produktsuche nach Mehl Lebensmittel fabrik übereinstimmen. Importeure wie Sie können großartige Angebote zu Fabrikpreisen für maschinen für die nahrungs, lebensmittel- maschine, nahrungsmittelmaschinen erhalten. Gemüsegroßhändler, Obstlieferanten, Exporteure von Milchprodukten, Nahrungsmittelhersteller, ungeachtet welche Lebensmittelexporteure in China Sie benötigen, hier werden Sie fündig. Nehmen Sie direkten Kontakt auf & erhalten Sie Preisangebote in Echtzeit!
Schnellproduktverzeichnis