Startseite » Produkt Suche » Industrielle Anlagen und Zusatzteile »

Trockanlage

( Über 17535 Produkte gefunden )
Produkt-Katalog Herstellerübersicht
Seite 165/585  
China-Lieferant - Gold-Mitglied Lizenz Verifizierte Lieferant
Sortieren nach: Bedeutung
Zeigen: 30 artikel

Henan 2014 Yuhong ISO9001 u. CER anerkanntes Sägemehl-Drehtrockner

Einheitspreis: US $ 10000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, EXW

Henan 2014 YUHONG ISO9001 u. CER anerkannter Lebendmasse-Rückstand-Drehtrockner für trocknenden Rückstand, Pumace, Holzspäne, Lebendmasse Warum zur Anwendung von YUHONG Wood Chips Rotary Dryer, Sawdust ...

Vakuum Rotary Dryer für Fruits

1 Produktname: Vakuumtrockner für Früchte Hauptanwendung 2: SZG Series Double Cone Rotating Vacuum Dryer hat rotierenden Tank des doppelten Kegels. Unter dem Zustand des Vakuums innerhalb des ...

Jiangyin Nez Machinery Technology Co., Ltd.

[Provinz: Jiangsu, China]

Niedrige Kosten-hölzerne Zweig-Luftstrom-Trockner-Maschine

Einheitspreis: US $ 2800.0-15000.0 / set
MOQ: 1 set

hölzerne Zweigluftstrom-Trocknermaschine Kurze Einleitung Trockenere/trocknende Maschine haben Typen zwei, einschließlich Luftstromtrocknermaschine und Drehwalzentrocknermaschine. Sie kann relative ...

GongYi HengYuan Industry Co., Ltd.

[Provinz: Henan, China]

Anbieter Lieferant

Heißer Verkaufs-Luftstrom-Drehtrommel-hölzerner Sägemehl-Trockner

Einheitspreis: US $ 2800.0-15000.0 / set
MOQ: 1 set

hölzerner Sägemehltrockner der Luftstromdrehtrommel Kurze Einleitung Trockenere/trocknende Maschine haben Typen zwei, einschließlich Luftstromtrocknermaschine und Drehwalzentrocknermaschine. Sie ...

GongYi HengYuan Industry Co., Ltd.

[Provinz: Henan, China]

Anbieter Lieferant

Hohe Kapazitäts-industrieller Puder-Trockner/Minidrehtrockner

Einheitspreis: US $ 2800.0-15000.0 / set
MOQ: 1 set

industrieller Pudertrockner/Minidrehtrockner Kurze Einleitung Trockenere/trocknende Maschine haben Typen zwei, einschließlich Luftstromtrocknermaschine und Drehwalzentrocknermaschine. Sie kann ...

GongYi HengYuan Industry Co., Ltd.

[Provinz: Henan, China]

Anbieter Lieferant

Hochgeschwindigkeitsfliehkraftspray-granulierender Trockner

Einheitspreis: US $ 5000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Anwendung des Spraytrockners Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für Labor verwendet; grosser Typ Spraytrockner ist für ...

China High Speed Spray Dryer für Ceramic

Einheitspreis: US $ 5000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Anwendung des Spraytrockners Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für Labor verwendet; grosser Typ Spraytrockner ist für ...

Spray Dryer for Ceramic Granule

Einheitspreis: US $ 5000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Application of spray dryer spray dryer is used for small industrial production purpose or for doing experiment, for lab; big type spray dryer is for mass industrial production of milk powder, protein, ...

Spray Dryer für Organic Solvent

Einheitspreis: US $ 5000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Anwendung des Spraytrockners Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für Labor verwendet; grosser Typ Spraytrockner ist für ...

Edelstahl Lab Spray Dryer für Small Production Test

Einheitspreis: US $ 7000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Experimenteller Spraytrockner Product Overview: Die Maschine verwendet gekapselt, alle Maschinenteile werden gebildet vom Edelstahl der Qualitäts 304, mit Mittel eines höheren Wiederanläufen der ...

HochgeschwindigkeitsCentrifugal Spray Dryer für Egg Powder

Einheitspreis: US $ 5000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

Spray-Trockner - trocknende Maschine (LPG-5)

Einheitspreis: US $ 5500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

Heißer Verkaufs-Spray-Trockner LPG-5

Einheitspreis: US $ 5500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

Lpg-Serien-Spray-trocknende Maschine (LPG-5)

Einheitspreis: US $ 5500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

GlasChamber Mini Spray Dryer für Lab/Pilot/Test

Einheitspreis: US $ 5000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Name: Kleiner Laborspraytrockner, Minispraytrockner, beweglicher Versuchsspraytrockner Beschreibung: Ist Minispraytrockner des labor OM1500 (Einheit) ein Division, das ich die neue Technologie ...

Lpg-Hochgeschwindigkeitsfliehkraftspray-Trockner-Maschine

Einheitspreis: US $ 5500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

Hochgeschwindigkeitsfliehkraftspray-Trockenturm-Maschine

Einheitspreis: US $ 5500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

Fliehkraftmilch-Spray-trocknende Maschine

Einheitspreis: US $ 5500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

Pharmazeutische Centifugal Spray-trocknende Hochgeschwindigkeitsmaschine GMP-

Einheitspreis: US $ 5500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

LPG Hohes-Speed Spray Dryer Equipment auf Sale

Einheitspreis: US $ 5500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

Heißer Verkaufs-Fliehkraftspray-Trockner (LPG)

Einheitspreis: US $ 5500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

Spray Dryer für Organic Solvent

Einheitspreis: US $ 5500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

Chinesisches Hot Sale Spray Dryer für Starch

Einheitspreis: US $ 5500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

Heißes Sale Spray Dryer für Vitamin

Einheitspreis: US $ 5500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

LPG Hohes-Speed Spray Dryer für Washing Powder

Einheitspreis: US $ 5500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

Kleine Labormaschinen-Kräuterpuder-Spray-Trockner

Einheitspreis: US $ 5500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

Laborstufe-pharmazeutischer Maschinen-Spray-Trockner

Einheitspreis: US $ 5500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

Industrielles Spray Dryer für Instant Coffee

Einheitspreis: US $ 5500 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

HochgeschwindigkeitsCentrifugal Spray Dryer für Dyestaff/Pigment

Einheitspreis: US $ 5000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

HochgeschwindigkeitsCentrifugal Spray Dryer für Drying Chemical Liquid

Einheitspreis: US $ 5000 / Stück
MOQ: 1 Stück
Handelsbedingungen: FOB, CFR, CIF, DDP, DAP, CIP, FCA, EXW

Spraytrocknernamen: Spraytrockner wird auch Spray trocknende Maschine genannt; Spraytrockner wird für kleinen Zweck der industriellen Industrieproduktion oder für das Handeln des Experimentes, für ...

Brauchen Sie Hilfe?
Kontaktieren Sie bitte uns.