Lieferanten mit verifizierten Geschäftslizenzen
Geprüfter Lieferant Anti-Aging FOXO4 D-Retro-Inverso Peptid 95% FOXO4-DRI 98% Senolytika Pulver
EGF, FGF, KGF, SOD, FOXO4-dri und alle kosmetischen Pulver.
Sowohl Rohpulver als auch gefrierdired Feinpulver sind erhältlich. 
Physische Zeichen und Spezifikationen
FOXO4-DRI Rohpulver und Gefrierpulver in Fläschchen liefern.
| Name | FOXO4 DRI |
| CAS | K. A. |
| Standard-Sorte | Einspritzqualität |
| COA | PLS-Kontakt mit Senwayer frei |
| MOQ | 10mg |
| Aussehen | Weißes Pulver |
| Reinheit, % (durch RP-HPLC) | 95 % |
| Aktivitätseinheit | K. A. |
| PH-Wert | K. A. |
| Isoelektrischer Punkt | K. A. |
| Wasserrückstände | K. A. |
| Identifizierungstest | K. A. |
| Lagerung | 2 - 8 Grad |
| EXSP-Zeit | 2 Jahre |
FOXO4 das D-Retro-Inverso-Peptid, auch bekannt als FOXO4 DRI-Peptid, wurde erstmals in Baar et al. In "Targeted Apoptosis of senescent cells regeneriert Gewebehomöostase in Response to Chemotoxicity and Aging" berichtet
FOXO4 DRI Peptid, das die Aminosäuresequenz enthält: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wobei die Aminosäuren in der Aminosäuresequenz D-Aminosäurereste sind. FOXO4 D-Retro-Inverso Peptid induziert selektiv Apoptose von seneszenten Zellen kehrt Effekte von Chemotoxizität und Alterung bei Mäusen um
| Nein | Produktname | CAS-Nr. |
| Anti-Falten & Anti-Aging Serie | ||
| 1 | Acetyl Hexapeptid-8 | 616204-22-9 |
| 2 | Acetyl Octapeptid-3/Snap-8 | 868844-74-0 |
| 3 | Palmitoyl Tripeptide-5 /Collagen Peptid | 623172-56-5 |
| 4 | Palmitoylpapeptid-4 /Matrixylacetat | 214047-00-4 |
| 5 | Pentapeptide-18/Leuphasil | 64963-01-5 |
| 6 | Hexapeptid-10/Serilesin | 146439-94-3 |
| 7 | Palmitoyl Hexapeptid/Lipopeptid-Acetat | 171263-26-6 |
| 8 | Palmitoyl Tripeptide-1 | 147732-56-7 |
| 9 | Pentapeptide-3/Vialox Peptid | 135679-88-8 |
| 10 | Acetyl Tetrapeptid-2 | 757942-88-4 |
| 11 | Acetyl Tetrapeptid-9 | 928006-50-2 |
| 12 | L-Carnosin | 305-84-0 |
| 13 | Decorinyl/Tripeptide-10 Citrullin | 960531-53-7 |
| 14 | Palmitoyl Tripeptide-38 | 1447824-23-8 |
| 15 | Acetyl-Decapeptid-3 | 935288-50-9 |
| 16 | Hexapeptid-11 | -------- |
| Bleaching & Freckle Removing Series | ||
| 1 | Nonapeptid-1/Melitane | 158563-45-2 |
| 2 | Tetrapeptide-30 | --------- |
| 3 | Decapeptide-12 | --------- |
| 4 | Hexapeptid-2 | --------- |
| 5 | Melanostatin DM. | 123689-72-5 |
| 6 | Oligopeptide-68 | 1206525-47-4 |
| Serie für Augenpflege und Haarwachstum | ||
| 1 | Acetyl Tetrapeptid-5 | 820959-17-9 |
| 2 | Myristoyl Pentapeptid-17 | 959610-30-1 |
| 3 | Myristoyl Tetrapeptid-12 | 959610-24-3 |
| 4 | Acetyl Tetrapeptid-3/Capixyl | 155149-79-4 |
| 5 | Biotinoyl Tripeptid-1 | 299157-54-3 |
| 6 | Melitan/Acetyl Hexapeptid-1 | 448944-47-6 |
| 7 | Myristoyl Pentapeptid-4 | --------- |
| Serie Anti-allergisch & Hautreparatur | ||
| 1 | Pal-Tetrapeptide-7/Pal-Tetrapeptide-3 | 221227-05-0 |
| 2 | Kupfer Peptid | 49557-75-7 |
| 3 | Hexapeptid-9 | 1228371-11-6 |
| 4 | Palmitoyl Tripeptide-8 | 936544-53-5 |
| 5 | Oligopeptide-10 | --------- |
| 6 | LZ1 Peptide | --------- |
| Serie Brust | ||
| 1 | Acetyl Hexapeptid-38 | 1400634-44-7 |
| Gewichtsverlust Serie | ||
| 1 | Acetyl Hexapeptid-39 | --------- |
Lieferanten mit verifizierten Geschäftslizenzen
Geprüfter Lieferant 
